DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eff and ube2m

DIOPT Version :10

Sequence 1:NP_731941.1 Gene:eff / 41785 FlyBaseID:FBgn0011217 Length:147 Species:Drosophila melanogaster
Sequence 2:NP_988956.1 Gene:ube2m / 394553 XenbaseID:XB-GENE-1005525 Length:183 Species:Xenopus tropicalis


Alignment Length:133 Identity:48/133 - (36%)
Similarity:74/133 - (55%) Gaps:4/133 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 RINKELQDLGRDPPAQCSAG-PVGDDLFHWQATIMGPPDSPYQGGVFFLTIHFPTDYPFKPPKVA 68
            ||.|::.:|  :.|..|... ...|||.:::..|. |.:..|:||.|..:......||..||||.
 Frog    33 RIQKDINEL--NLPKTCEIEFSDHDDLLNFKLVIC-PDEGFYKGGKFVFSFKVGQGYPHDPPKVK 94

  Fly    69 FTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREK 133
            ..|.:|||||:..|::||:|||..|.|.|||:.::..:..|..:|||:|||..|.|.:.:.:|..
 Frog    95 CETMVYHPNIDLEGNVCLNILREDWKPVLTINSIIYGLQYLFLEPNPEDPLNKEAAEVLQNNRRL 159

  Fly   134 YNE 136
            :.:
 Frog   160 FEQ 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
effNP_731941.1 UBCc_UBE2D 3..145 CDD:467412 48/133 (36%)
ube2mNP_988956.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..28
UBCc_UBE2F_UBE2M 29..166 CDD:467414 48/133 (36%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.