DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eff and ube2d1a

DIOPT Version :9

Sequence 1:NP_001262578.1 Gene:eff / 41785 FlyBaseID:FBgn0011217 Length:147 Species:Drosophila melanogaster
Sequence 2:NP_957404.1 Gene:ube2d1a / 394085 ZFINID:ZDB-GENE-040426-1609 Length:147 Species:Danio rerio


Alignment Length:147 Identity:132/147 - (89%)
Similarity:142/147 - (96%) Gaps:0/147 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MALKRINKELQDLGRDPPAQCSAGPVGDDLFHWQATIMGPPDSPYQGGVFFLTIHFPTDYPFKPP 65
            ||||||.||||||.||||:||||||:|:||||||||||||.||||||||||||||||||||||||
Zfish     1 MALKRIQKELQDLQRDPPSQCSAGPLGEDLFHWQATIMGPGDSPYQGGVFFLTIHFPTDYPFKPP 65

  Fly    66 KVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTD 130
            ||||||:||||||||||||||||||||||||||:||||||||||||||||||||||:||.|||:|
Zfish    66 KVAFTTKIYHPNINSNGSICLDILRSQWSPALTVSKVLLSICSLLCDPNPDDPLVPDIAHIYKSD 130

  Fly   131 REKYNELAREWTRKYAM 147
            ::|||.||||||:||||
Zfish   131 KDKYNRLAREWTQKYAM 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
effNP_001262578.1 UBCc 1..146 CDD:412187 129/144 (90%)
ube2d1aNP_957404.1 COG5078 1..147 CDD:227410 130/145 (90%)
UBCc 1..146 CDD:294101 129/144 (90%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170581753
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0417
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53976
OrthoDB 1 1.010 - - D1337945at2759
OrthoFinder 1 1.000 - - FOG0000418
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100671
Panther 1 1.100 - - O PTHR24068
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X311
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1211.720

Return to query results.
Submit another query.