DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eff and ube2d2

DIOPT Version :9

Sequence 1:NP_001262578.1 Gene:eff / 41785 FlyBaseID:FBgn0011217 Length:147 Species:Drosophila melanogaster
Sequence 2:NP_957253.1 Gene:ube2d2 / 393934 ZFINID:ZDB-GENE-120312-1 Length:147 Species:Danio rerio


Alignment Length:147 Identity:140/147 - (95%)
Similarity:144/147 - (97%) Gaps:0/147 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MALKRINKELQDLGRDPPAQCSAGPVGDDLFHWQATIMGPPDSPYQGGVFFLTIHFPTDYPFKPP 65
            ||||||:|||.||||||||||||||||||:||||||||||.||||||||||||||||||||||||
Zfish     1 MALKRIHKELHDLGRDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPP 65

  Fly    66 KVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTD 130
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Zfish    66 KVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTD 130

  Fly   131 REKYNELAREWTRKYAM 147
            |||||.:|||||:||||
Zfish   131 REKYNRIAREWTQKYAM 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
effNP_001262578.1 UBCc 1..146 CDD:412187 137/144 (95%)
ube2d2NP_957253.1 UBCc 1..146 CDD:412187 137/144 (95%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 285 1.000 Domainoid score I1578
eggNOG 1 0.900 - - E2759_KOG0417
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H2506
Inparanoid 1 1.050 302 1.000 Inparanoid score I2654
OMA 1 1.010 - - QHG53976
OrthoDB 1 1.010 - - D1337945at2759
OrthoFinder 1 1.000 - - FOG0000418
OrthoInspector 1 1.000 - - otm24822
orthoMCL 1 0.900 - - OOG6_100671
Panther 1 1.100 - - O PTHR24068
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X311
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1413.840

Return to query results.
Submit another query.