DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eff and CG17030

DIOPT Version :9

Sequence 1:NP_001262578.1 Gene:eff / 41785 FlyBaseID:FBgn0011217 Length:147 Species:Drosophila melanogaster
Sequence 2:NP_647941.1 Gene:CG17030 / 38591 FlyBaseID:FBgn0035584 Length:180 Species:Drosophila melanogaster


Alignment Length:156 Identity:49/156 - (31%)
Similarity:81/156 - (51%) Gaps:24/156 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KRINKEL------------QDLGRDPPAQCSAGPVGDDLFHWQATIMGPPDSPYQGGVFFLTIHF 56
            ||:|:||            ::|..:|          ::::.|...:| |...||..|.:.:.|.|
  Fly    13 KRMNRELALMLEDKQNLQFRNLLVEP----------NNIYKWTGLLM-PVAPPYDKGAYKMEIDF 66

  Fly    57 PTDYPFKPPKVAFTTRIYHPNINSNGSICLDILR-SQWSPALTISKVLLSICSLLCDPNPDDPLV 120
            |.|||||||::...||:||.|:|..|.:|:.||. ..|.|...|.:||..:.:.:.||.|::...
  Fly    67 PLDYPFKPPRIHINTRMYHLNVNERGQVCVPILEVEHWIPTTRIDQVLQVLLATINDPQPENAWH 131

  Fly   121 PEIARIYKTDREKYNELAREWTRKYA 146
            .|:|..|:.|..::.::|..|.:||:
  Fly   132 IEMAGEYRNDPVRFFKMADAWVQKYS 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
effNP_001262578.1 UBCc 1..146 CDD:412187 48/154 (31%)
CG17030NP_647941.1 COG5078 12..158 CDD:227410 49/156 (31%)
UQ_con 14..153 CDD:278603 45/149 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442207
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24068
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.