DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eff and Ubc10

DIOPT Version :9

Sequence 1:NP_001262578.1 Gene:eff / 41785 FlyBaseID:FBgn0011217 Length:147 Species:Drosophila melanogaster
Sequence 2:NP_477414.1 Gene:Ubc10 / 37035 FlyBaseID:FBgn0026316 Length:154 Species:Drosophila melanogaster


Alignment Length:153 Identity:60/153 - (39%)
Similarity:90/153 - (58%) Gaps:15/153 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 ALKRINKELQDLG-------RDPPAQCSAGPVGDDLFHWQATIMGPPDSPYQGGVFFLTIHFPTD 59
            |.:|:.|||.||.       ||..|.      .|:|..|...|: |.:.||..|.|.:.|:||.:
  Fly     3 APRRLRKELSDLQGNALKSFRDIKAD------DDNLLRWTGLIV-PDNPPYNKGAFRIEINFPAE 60

  Fly    60 YPFKPPKVAFTTRIYHPNINSNGSICLDILRSQ-WSPALTISKVLLSICSLLCDPNPDDPLVPEI 123
            |||||||:.|.||||||||:..|.:||.|:.:: |.||....:|:.::..|:.||.|:.||..|:
  Fly    61 YPFKPPKINFKTRIYHPNIDEKGQVCLPIISTENWKPATRTDQVVQALVDLINDPEPEHPLRAEL 125

  Fly   124 ARIYKTDREKYNELAREWTRKYA 146
            |..:..||:|:.:.|.::|:|::
  Fly   126 AEEFLKDRKKFVKNAEDYTKKHS 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
effNP_001262578.1 UBCc 1..146 CDD:412187 60/151 (40%)
Ubc10NP_477414.1 UQ_con 6..144 CDD:395127 57/144 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442208
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24068
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.