DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eff and CG4502

DIOPT Version :9

Sequence 1:NP_001262578.1 Gene:eff / 41785 FlyBaseID:FBgn0011217 Length:147 Species:Drosophila melanogaster
Sequence 2:NP_609103.1 Gene:CG4502 / 34002 FlyBaseID:FBgn0031896 Length:306 Species:Drosophila melanogaster


Alignment Length:160 Identity:41/160 - (25%)
Similarity:73/160 - (45%) Gaps:35/160 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KRINKELQDLGR---DPPAQCSAGPVGDDLFHWQATI-MGPPDSPY-----QGGVFFLTIH--FP 57
            :|:.||.:::.|   ...|..:...|.|.||.|...: :..||||.     :.||..:.:|  ||
  Fly   141 RRLMKEYREMERLQAKNDAVFTVELVNDSLFEWHVRLHVIDPDSPLARDMAEMGVPAILLHLSFP 205

  Fly    58 TDYPFKPPKVAFTTRIYHPNIN-----SNGSICLDILRSQ-WSPALTISKVLLSICSLLCDPNPD 116
            .::||.||.:    |:..|:|.     ..|:||:::|..: |:.|.|:..|::...:        
  Fly   206 DNFPFAPPFM----RVVEPHIEKGYVMEGGAICMELLTPRGWASAYTVEAVIMQFAA-------- 258

  Fly   117 DPLVPEIARIYKTDREKYNELAREWTRKYA 146
             .:|....||.:..:.     .:|:||:.|
  Fly   259 -SVVKGQGRIARKPKS-----TKEFTRRQA 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
effNP_001262578.1 UBCc 1..146 CDD:412187 40/158 (25%)
CG4502NP_609103.1 UBCc 140..>258 CDD:238117 34/120 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442205
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24068
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.