DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eff and ube2l3b

DIOPT Version :9

Sequence 1:NP_001262578.1 Gene:eff / 41785 FlyBaseID:FBgn0011217 Length:147 Species:Drosophila melanogaster
Sequence 2:NP_001076266.1 Gene:ube2l3b / 321943 ZFINID:ZDB-GENE-030131-662 Length:190 Species:Danio rerio


Alignment Length:118 Identity:49/118 - (41%)
Similarity:77/118 - (65%) Gaps:2/118 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 DLFHWQATIMGPPDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQ- 92
            ::..||..|: |.:.||..|.|.:.|.||.:|||||||:.|.|:||||||:..|.:||.::.:: 
Zfish    67 NILTWQGLIV-PDNPPYDKGAFRIEIIFPAEYPFKPPKITFKTKIYHPNIDEKGQVCLPVISAEN 130

  Fly    93 WSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNELAREWTRKY 145
            |.||....:|:.|:.:|:.||.|:.||..::|..|..||:|:.:.|.|:|:|:
Zfish   131 WKPATKTDQVIQSLIALVNDPQPEHPLRADLAEEYSKDRKKFFKNAEEFTKKH 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
effNP_001262578.1 UBCc 1..146 CDD:412187 49/118 (42%)
ube2l3bNP_001076266.1 COG5078 44..186 CDD:227410 49/118 (42%)
UBCc 46..185 CDD:214562 49/118 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.