DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eff and ube2kb

DIOPT Version :9

Sequence 1:NP_001262578.1 Gene:eff / 41785 FlyBaseID:FBgn0011217 Length:147 Species:Drosophila melanogaster
Sequence 2:NP_001008611.1 Gene:ube2kb / 30100 ZFINID:ZDB-GENE-980605-9 Length:200 Species:Danio rerio


Alignment Length:150 Identity:63/150 - (42%)
Similarity:92/150 - (61%) Gaps:4/150 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MALKRINKELQDLGRDPPA---QCSAGPVGDDLFHWQATIMGPPDSPYQGGVFFLTIHFPTDYPF 62
            :|::||.:|.:::.:....   |.....|.::....:..|.||||:||:||.:.|.|..|..|||
Zfish     4 IAVQRIKREFKEVLKSEETSKNQIKVDLVDENFTELKGEIAGPPDTPYEGGRYQLEIKIPETYPF 68

  Fly    63 KPPKVAFTTRIYHPNINS-NGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARI 126
            .||||.|.|:|:||||:| .|:||||||:.||:.|:|:..||||:.:||....||||....:|..
Zfish    69 NPPKVRFITKIWHPNISSVTGAICLDILKDQWAAAMTLRTVLLSLQALLAAAEPDDPQDAVVANQ 133

  Fly   127 YKTDREKYNELAREWTRKYA 146
            ||.:.|.:.:.||.|:..||
Zfish   134 YKQNPEMFKQTARLWSHVYA 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
effNP_001262578.1 UBCc 1..146 CDD:412187 61/148 (41%)
ube2kbNP_001008611.1 UBCc 6..148 CDD:238117 59/141 (42%)
UBA_II_E2_UBE2K 163..200 CDD:270573
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.