DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eff and UBE2T

DIOPT Version :9

Sequence 1:NP_001262578.1 Gene:eff / 41785 FlyBaseID:FBgn0011217 Length:147 Species:Drosophila melanogaster
Sequence 2:NP_054895.1 Gene:UBE2T / 29089 HGNCID:25009 Length:197 Species:Homo sapiens


Alignment Length:146 Identity:61/146 - (41%)
Similarity:92/146 - (63%) Gaps:4/146 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 RINKELQDLGRDPPAQCSAGPVGDDLFHWQATIMGPPDSPYQGGVFFLTIHFPTDYPFKPPKVAF 69
            |:.:||..|..:||...:.....|.:...:|.|:|..::||:.|||.|.:..|..|||:||::.|
Human     6 RLKRELHMLATEPPPGITCWQDKDQMDDLRAQILGGANTPYEKGVFKLEVIIPERYPFEPPQIRF 70

  Fly    70 TTRIYHPNINSNGSICLDIL----RSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTD 130
            .|.||||||:|.|.||||:|    :..|.|:|.|:.||.||..|:.:|||||||:.:|:..:|.:
Human    71 LTPIYHPNIDSAGRICLDVLKLPPKGAWRPSLNIATVLTSIQLLMSEPNPDDPLMADISSEFKYN 135

  Fly   131 REKYNELAREWTRKYA 146
            :..:.:.||:||.|:|
Human   136 KPAFLKNARQWTEKHA 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
effNP_001262578.1 UBCc 1..146 CDD:412187 60/144 (42%)
UBE2TNP_054895.1 UBCc 5..147 CDD:238117 57/140 (41%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 149..197 2/3 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53976
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.