DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eff and Ube2i

DIOPT Version :9

Sequence 1:NP_001262578.1 Gene:eff / 41785 FlyBaseID:FBgn0011217 Length:147 Species:Drosophila melanogaster
Sequence 2:NP_037182.1 Gene:Ube2i / 25573 RGDID:3926 Length:158 Species:Rattus norvegicus


Alignment Length:153 Identity:55/153 - (35%)
Similarity:84/153 - (54%) Gaps:7/153 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MALKRINKELQDLGRDPPAQCSAGPVGD-----DLFHWQATIMGPPDSPYQGGVFFLTIHFPTDY 60
            :||.|:.:|.:...:|.|....|.|..:     :|.:|:..|.|...:|::||:|.|.:.|..||
  Rat     4 IALSRLAQERKAWRKDHPFGFVAVPTKNPDGTMNLMNWECAIPGKKGTPWEGGLFKLRMLFKDDY 68

  Fly    61 PFKPPKVAFTTRIYHPNINSNGSICLDILR--SQWSPALTISKVLLSICSLLCDPNPDDPLVPEI 123
            |..|||..|...::|||:..:|::||.||.  ..|.||:||.::||.|..||.:||..||...|.
  Rat    69 PSSPPKCKFEPPLFHPNVYPSGTVCLSILEEDKDWRPAITIKQILLGIQELLNEPNIQDPAQAEA 133

  Fly   124 ARIYKTDREKYNELAREWTRKYA 146
            ..||..:|.:|.:..|...:|:|
  Rat   134 YTIYCQNRVEYEKRVRAQAKKFA 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
effNP_001262578.1 UBCc 1..146 CDD:412187 54/151 (36%)
Ube2iNP_037182.1 UQ_con 8..152 CDD:395127 51/143 (36%)
Interaction with SUMO1. /evidence=ECO:0000250 13..18 0/4 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.