DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eff and ubc14

DIOPT Version :9

Sequence 1:NP_001262578.1 Gene:eff / 41785 FlyBaseID:FBgn0011217 Length:147 Species:Drosophila melanogaster
Sequence 2:NP_594859.1 Gene:ubc14 / 2541565 PomBaseID:SPAC1250.03 Length:155 Species:Schizosaccharomyces pombe


Alignment Length:144 Identity:67/144 - (46%)
Similarity:93/144 - (64%) Gaps:1/144 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KRINKELQDLGRDPPAQCSAGPVGDDLFHWQATIMGPPDSPYQGGVFFLTIHFPTDYPFKPPKVA 68
            :|:.||..||...|........|.|:||||..|.:||.||.|.||.|..::.||.||||:||.:.
pombe    10 RRLTKEYSDLREHPIPDIRVNLVDDNLFHWACTALGPSDSVYAGGKFHFSLKFPLDYPFQPPTIE 74

  Fly    69 FTTRIYHPNINSNGSICLDILRSQ-WSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDRE 132
            |||||||||.:|.|::||.||:.| :.|::.:..||..|..||.:||||||||..||..|:.||.
pombe    75 FTTRIYHPNFDSEGNVCLAILKQQVFKPSIKLRSVLEQILQLLREPNPDDPLVASIAEQYRNDRP 139

  Fly   133 KYNELAREWTRKYA 146
            .::::||::..::|
pombe   140 SFDKIARDYVEQFA 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
effNP_001262578.1 UBCc 1..146 CDD:412187 66/142 (46%)
ubc14NP_594859.1 COG5078 12..154 CDD:227410 66/142 (46%)
UQ_con 12..149 CDD:278603 65/136 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0417
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24068
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.