DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eff and Ube2e1

DIOPT Version :9

Sequence 1:NP_001262578.1 Gene:eff / 41785 FlyBaseID:FBgn0011217 Length:147 Species:Drosophila melanogaster
Sequence 2:NP_033481.1 Gene:Ube2e1 / 22194 MGIID:107411 Length:193 Species:Mus musculus


Alignment Length:143 Identity:94/143 - (65%)
Similarity:112/143 - (78%) Gaps:0/143 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KRINKELQDLGRDPPAQCSAGPVGDDLFHWQATIMGPPDSPYQGGVFFLTIHFPTDYPFKPPKVA 68
            |||.|||.|:..|||..|||||.||:::.|::||:|||.|.|:||||||.|.|..:||||||||.
Mouse    50 KRIQKELADITLDPPPNCSAGPKGDNIYEWRSTILGPPGSVYEGGVFFLDITFTPEYPFKPPKVT 114

  Fly    69 FTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREK 133
            |.|||||.||||.|.||||||:..||||||||||||||||||.|.||.||||..||..|.|:|.:
Mouse   115 FRTRIYHCNINSQGVICLDILKDNWSPALTISKVLLSICSLLTDCNPADPLVGSIATQYMTNRAE 179

  Fly   134 YNELAREWTRKYA 146
            ::.:||:||::||
Mouse   180 HDRMARQWTKRYA 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
effNP_001262578.1 UBCc 1..146 CDD:412187 92/141 (65%)
Ube2e1NP_033481.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..45
UQ_con 51..188 CDD:395127 89/136 (65%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0417
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53976
OrthoDB 1 1.010 - - D1337945at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.830

Return to query results.
Submit another query.