DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eff and Ube2e1

DIOPT Version :10

Sequence 1:NP_731941.1 Gene:eff / 41785 FlyBaseID:FBgn0011217 Length:147 Species:Drosophila melanogaster
Sequence 2:NP_033481.1 Gene:Ube2e1 / 22194 MGIID:107411 Length:193 Species:Mus musculus


Alignment Length:143 Identity:94/143 - (65%)
Similarity:112/143 - (78%) Gaps:0/143 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KRINKELQDLGRDPPAQCSAGPVGDDLFHWQATIMGPPDSPYQGGVFFLTIHFPTDYPFKPPKVA 68
            |||.|||.|:..|||..|||||.||:::.|::||:|||.|.|:||||||.|.|..:||||||||.
Mouse    50 KRIQKELADITLDPPPNCSAGPKGDNIYEWRSTILGPPGSVYEGGVFFLDITFTPEYPFKPPKVT 114

  Fly    69 FTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREK 133
            |.|||||.||||.|.||||||:..||||||||||||||||||.|.||.||||..||..|.|:|.:
Mouse   115 FRTRIYHCNINSQGVICLDILKDNWSPALTISKVLLSICSLLTDCNPADPLVGSIATQYMTNRAE 179

  Fly   134 YNELAREWTRKYA 146
            ::.:||:||::||
Mouse   180 HDRMARQWTKRYA 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
effNP_731941.1 UBCc_UBE2D 3..145 CDD:467412 92/140 (66%)
Ube2e1NP_033481.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..45
UBCc_UBE2E 50..190 CDD:467413 92/139 (66%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.