DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eff and Ube2e2

DIOPT Version :9

Sequence 1:NP_001262578.1 Gene:eff / 41785 FlyBaseID:FBgn0011217 Length:147 Species:Drosophila melanogaster
Sequence 2:XP_017171445.1 Gene:Ube2e2 / 218793 MGIID:2384997 Length:239 Species:Mus musculus


Alignment Length:157 Identity:94/157 - (59%)
Similarity:112/157 - (71%) Gaps:14/157 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KRINKELQDLGRDPPAQC--------------SAGPVGDDLFHWQATIMGPPDSPYQGGVFFLTI 54
            |||.|||.::..|||..|              ||||.||:::.|::||:|||.|.|:||||||.|
Mouse    82 KRIQKELAEITLDPPPNCRHMFYDSKWVPEALSAGPKGDNIYEWRSTILGPPGSVYEGGVFFLDI 146

  Fly    55 HFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPL 119
            .|..|||||||||.|.|||||.||||.|.||||||:..||||||||||||||||||.|.||.|||
Mouse   147 TFSPDYPFKPPKVTFRTRIYHCNINSQGVICLDILKDNWSPALTISKVLLSICSLLTDCNPADPL 211

  Fly   120 VPEIARIYKTDREKYNELAREWTRKYA 146
            |..||..|.|:|.:::.:||:||::||
Mouse   212 VGSIATQYMTNRAEHDRMARQWTKRYA 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
effNP_001262578.1 UBCc 1..146 CDD:412187 92/155 (59%)
Ube2e2XP_017171445.1 UQ_con 83..234 CDD:365926 89/150 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0417
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53976
OrthoDB 1 1.010 - - D1337945at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.830

Return to query results.
Submit another query.