DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eff and Ube2d1

DIOPT Version :9

Sequence 1:NP_001262578.1 Gene:eff / 41785 FlyBaseID:FBgn0011217 Length:147 Species:Drosophila melanogaster
Sequence 2:XP_006513541.1 Gene:Ube2d1 / 216080 MGIID:2384911 Length:160 Species:Mus musculus


Alignment Length:142 Identity:126/142 - (88%)
Similarity:135/142 - (95%) Gaps:0/142 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 INKELQDLGRDPPAQCSAGPVGDDLFHWQATIMGPPDSPYQGGVFFLTIHFPTDYPFKPPKVAFT 70
            |.|||.||.|||||.|||||||||||||||||||||||.|||||||||:||||||||||||:|||
Mouse    19 IQKELSDLQRDPPAHCSAGPVGDDLFHWQATIMGPPDSAYQGGVFFLTVHFPTDYPFKPPKIAFT 83

  Fly    71 TRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYN 135
            |:||||||||||||||||||||||||||:||||||||||||||||||||||:||:|||:|:||||
Mouse    84 TKIYHPNINSNGSICLDILRSQWSPALTVSKVLLSICSLLCDPNPDDPLVPDIAQIYKSDKEKYN 148

  Fly   136 ELAREWTRKYAM 147
            ..|||||:||||
Mouse   149 RHAREWTQKYAM 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
effNP_001262578.1 UBCc 1..146 CDD:412187 123/139 (88%)
Ube2d1XP_006513541.1 UBCc 19..159 CDD:381827 123/139 (88%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167837956
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0417
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53976
OrthoDB 1 1.010 - - D1337945at2759
OrthoFinder 1 1.000 - - FOG0000418
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100671
Panther 1 1.100 - - O PTHR24068
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2321
SonicParanoid 1 1.000 - - X311
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.750

Return to query results.
Submit another query.