DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eff and ubc-24

DIOPT Version :9

Sequence 1:NP_001262578.1 Gene:eff / 41785 FlyBaseID:FBgn0011217 Length:147 Species:Drosophila melanogaster
Sequence 2:NP_495769.2 Gene:ubc-24 / 186057 WormBaseID:WBGene00006719 Length:160 Species:Caenorhabditis elegans


Alignment Length:155 Identity:48/155 - (30%)
Similarity:77/155 - (49%) Gaps:26/155 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LKRINKELQDLGRDPP---------AQCSAGPVGDDLFHWQATIMGPPDSP-YQGGVFFLTIHFP 57
            |.||.||:.||.::..         .:|.      |:|  |..|:|  |.. |:..:|.||:...
 Worm    15 LSRIRKEIADLAKNKRRFIKDFRKIEKCK------DIF--QFKIIG--DGVLYKNMIFTLTLDVN 69

  Fly    58 TDYPFKPPKVAFTTRIYHPNINS-NGSICLD-ILRSQWSPALTISKVLLSICSLLCDPNPDDPLV 120
            .:||||||.:.|...:||||::. ...:|.. :|:..|.|..|:..|||::..||.:|:...|:.
 Worm    70 VEYPFKPPYLKFCHNVYHPNVDPVTCELCSPMLLQENWKPETTMEDVLLNLIVLLNEPDLSRPVN 134

  Fly   121 PEIARIYKTDR----EKYNELAREW 141
            .:.|..|..::    :|..|||::|
 Worm   135 IDAAHDYIHNKVEFVKKSTELAKKW 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
effNP_001262578.1 UBCc 1..146 CDD:412187 48/155 (31%)
ubc-24NP_495769.2 UBCc 17..160 CDD:214562 47/153 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24068
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.