DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eff and ubc-22

DIOPT Version :10

Sequence 1:NP_731941.1 Gene:eff / 41785 FlyBaseID:FBgn0011217 Length:147 Species:Drosophila melanogaster
Sequence 2:NP_509501.2 Gene:ubc-22 / 182322 WormBaseID:WBGene00006717 Length:182 Species:Caenorhabditis elegans


Alignment Length:117 Identity:36/117 - (30%)
Similarity:57/117 - (48%) Gaps:23/117 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 FHWQATIMGPPDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNIN-SNGSICLDILRSQWS 94
            ||    |.||.|:||:.|||.:.:.||.:||...|::.|.|.|::..:. |.|.:.::    .:|
 Worm    33 FH----IAGPADTPYETGVFEVDLTFPDNYPNALPQIKFQTLIWNCAVEPSTGQVHIE----NYS 89

  Fly    95 PALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNELAREWTRKYA 146
             .|.:|:.|..|..|......|:.::     .|||        ||.||.::|
 Worm    90 -RLNVSEALSYIEDLFRSIEVDEEVM-----FYKT--------ARFWTTEFA 127

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
effNP_731941.1 UBCc_UBE2D 3..145 CDD:467412 35/114 (31%)
ubc-22NP_509501.2 UBCc_UEV 21..107 CDD:467407 27/82 (33%)
UBA_like_SF 139..174 CDD:473871
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.