DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eff and UBE2U

DIOPT Version :9

Sequence 1:NP_001262578.1 Gene:eff / 41785 FlyBaseID:FBgn0011217 Length:147 Species:Drosophila melanogaster
Sequence 2:NP_001353161.1 Gene:UBE2U / 148581 HGNCID:28559 Length:317 Species:Homo sapiens


Alignment Length:145 Identity:49/145 - (33%)
Similarity:82/145 - (56%) Gaps:3/145 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 INKELQDLGRDPPAQCSAGPVGDDLFHWQATIMGPPDSPYQGGVFFLTIHFPTDYPFKPPKVAFT 70
            ::::..||..:.....:|.||.:|:..|:..|.|..:|.:||.||.|||||.::|.:.||.|.|.
Human     9 LHRDFCDLKENNYKGITAKPVSEDMMEWEVEIEGLQNSVWQGLVFQLTIHFTSEYNYAPPVVKFI 73

  Fly    71 TRIYHPNINSN-GSICLDILRS--QWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDRE 132
            |..:|||::.: |..|:|.|.:  :|:...|:|.:||::..:|.:|..::|:..|.|||...|..
Human    74 TIPFHPNVDPHTGQPCIDFLDNPEKWNTNYTLSSILLALQVMLSNPVLENPVNLEAARILVKDES 138

  Fly   133 KYNELAREWTRKYAM 147
            .|..:.|.:.|...|
Human   139 LYRTILRLFNRPLQM 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
effNP_001262578.1 UBCc 1..146 CDD:412187 48/142 (34%)
UBE2UNP_001353161.1 UBCc 8..147 CDD:238117 47/137 (34%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 281..317
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.