DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eff and UBE2F

DIOPT Version :10

Sequence 1:NP_731941.1 Gene:eff / 41785 FlyBaseID:FBgn0011217 Length:147 Species:Drosophila melanogaster
Sequence 2:NP_542409.1 Gene:UBE2F / 140739 HGNCID:12480 Length:185 Species:Homo sapiens


Alignment Length:151 Identity:52/151 - (34%)
Similarity:74/151 - (49%) Gaps:9/151 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KRINKELQDLGRDPPAQCSAG-PVGDDLFHWQATIMGPPDSPYQGGVFFLTIHFPTDYPFKPPKV 67
            |.:.||:.:|..:.|..|... |..:.|..:|.|:. |.:..||||.|......|..|...||||
Human    35 KLLVKEVAELEANLPCTCKVHFPDPNKLHCFQLTVT-PDEGYYQGGKFQFETEVPDAYNMVPPKV 98

  Fly    68 AFTTRIYHPNINSNGSICLDILRSQ------WSPALTISKVLLSICSLLCD-PNPDDPLVPEIAR 125
            ...|:|:||||...|.|||.:||..      |:|..|:..|:..:.||..| .|.||||..|.|.
Human    99 KCLTKIWHPNITETGEICLSLLREHSIDGTGWAPTRTLKDVVWGLNSLFTDLLNFDDPLNIEAAE 163

  Fly   126 IYKTDREKYNELAREWTRKYA 146
            .:..|:|.:.....::.::||
Human   164 HHLRDKEDFRNKVDDYIKRYA 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
effNP_731941.1 UBCc_UBE2D 3..145 CDD:467412 50/148 (34%)
UBE2FNP_542409.1 Interaction with UBA3. /evidence=ECO:0000269|PubMed:19250909 1..29
UBCc_UBE2F_UBE2M 32..176 CDD:467414 50/141 (35%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.