DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eff and Ube2d4l1

DIOPT Version :9

Sequence 1:NP_001262578.1 Gene:eff / 41785 FlyBaseID:FBgn0011217 Length:147 Species:Drosophila melanogaster
Sequence 2:XP_038956229.1 Gene:Ube2d4l1 / 100359803 RGDID:2323338 Length:147 Species:Rattus norvegicus


Alignment Length:147 Identity:124/147 - (84%)
Similarity:135/147 - (91%) Gaps:0/147 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MALKRINKELQDLGRDPPAQCSAGPVGDDLFHWQATIMGPPDSPYQGGVFFLTIHFPTDYPFKPP 65
            ||||||.|||.||.||||.||||||||:|:||||||||||.|||||||||||.||||||||||||
  Rat     1 MALKRIEKELLDLARDPPTQCSAGPVGEDMFHWQATIMGPDDSPYQGGVFFLAIHFPTDYPFKPP 65

  Fly    66 KVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTD 130
            |:.|||||||||||..||||||||||:||||||:|||||||||||||||||||||||||:||:.|
  Rat    66 KITFTTRIYHPNINRKGSICLDILRSEWSPALTVSKVLLSICSLLCDPNPDDPLVPEIAKIYRKD 130

  Fly   131 REKYNELAREWTRKYAM 147
            ::||:.||||||.|:||
  Rat   131 KKKYDRLAREWTEKFAM 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
effNP_001262578.1 UBCc 1..146 CDD:412187 122/144 (85%)
Ube2d4l1XP_038956229.1 UBCc 1..146 CDD:412187 122/144 (85%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24068
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.