DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eff and ube2e2

DIOPT Version :9

Sequence 1:NP_001262578.1 Gene:eff / 41785 FlyBaseID:FBgn0011217 Length:147 Species:Drosophila melanogaster
Sequence 2:NP_001119983.1 Gene:ube2e2 / 100144938 XenbaseID:XB-GENE-5800934 Length:201 Species:Xenopus tropicalis


Alignment Length:143 Identity:94/143 - (65%)
Similarity:112/143 - (78%) Gaps:0/143 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KRINKELQDLGRDPPAQCSAGPVGDDLFHWQATIMGPPDSPYQGGVFFLTIHFPTDYPFKPPKVA 68
            |||.|||.::..|||..|||||.||:::.|::||:|||.|.|:||||||.|.|..|||||||||.
 Frog    58 KRIQKELAEITLDPPPNCSAGPKGDNIYEWRSTILGPPGSVYEGGVFFLDIAFSPDYPFKPPKVT 122

  Fly    69 FTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREK 133
            |.|||||.||||.|.||||||:..||||||||||||||||||.|.||.||||..||..|.|:|.:
 Frog   123 FRTRIYHCNINSQGVICLDILKDNWSPALTISKVLLSICSLLTDCNPADPLVGSIATQYMTNRAE 187

  Fly   134 YNELAREWTRKYA 146
            ::.:||:||::||
 Frog   188 HDRMARQWTKRYA 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
effNP_001262578.1 UBCc 1..146 CDD:412187 92/141 (65%)
ube2e2NP_001119983.1 UQ_con 59..196 CDD:365926 89/136 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1337945at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.