DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eff and birc6

DIOPT Version :9

Sequence 1:NP_001262578.1 Gene:eff / 41785 FlyBaseID:FBgn0011217 Length:147 Species:Drosophila melanogaster
Sequence 2:XP_031758792.1 Gene:birc6 / 100135722 XenbaseID:XB-GENE-1001894 Length:4834 Species:Xenopus tropicalis


Alignment Length:135 Identity:42/135 - (31%)
Similarity:66/135 - (48%) Gaps:31/135 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 IMGPPDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTR-----IYHPNINSNGSICLDILRS----- 91
            |.||.|:||..|.|...::||.|||..||.|...|.     .::||:.::|.:||.||.:     
 Frog  4590 ITGPADTPYANGCFEFDVYFPQDYPNSPPLVNLETTGGHSVRFNPNLYNDGKVCLSILNTWHGRP 4654

  Fly    92 --QWSP-ALTISKVLLSICSLL--CDPNPDDPLVPEIARIYKTDR---------EKYNELAREWT 142
              :|:| ..:..:||:||.||:  .:|..::|       .|:..|         .:|:...|:.|
 Frog  4655 EEKWNPQTSSFLQVLVSIQSLILVSEPYFNEP-------GYERSRGTPGGTQSSREYDGNIRQAT 4712

  Fly   143 RKYAM 147
            .|:||
 Frog  4713 VKWAM 4717

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
effNP_001262578.1 UBCc 1..146 CDD:412187 40/132 (30%)
birc6XP_031758792.1 BIR 240..313 CDD:237989
BIRC6 3442..3597 CDD:403536
UBCc 4574..4686 CDD:238117 33/95 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.