DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7530 and IZH4

DIOPT Version :9

Sequence 1:NP_650387.1 Gene:CG7530 / 41784 FlyBaseID:FBgn0038256 Length:351 Species:Drosophila melanogaster
Sequence 2:NP_014540.1 Gene:IZH4 / 854052 SGDID:S000005461 Length:312 Species:Saccharomyces cerevisiae


Alignment Length:228 Identity:55/228 - (24%)
Similarity:99/228 - (43%) Gaps:14/228 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 NETINIWSHLAGCILFIGLTIFDLQFLRL-----HASLSDQVLV-VCLLVCFCLCMLMSAIYH-I 172
            ||::....:|.|.:|...|.||...|..:     ..:::|.::. ..||..|..|| :..||| :
Yeast    62 NESLVALIYLLGSMLSFCLLIFFTDFYLIPLFPTTTTMTDYIVFNFYLLNVFVFCM-VHFIYHFV 125

  Fly   173 FSCKSEEHYELFLSVDFLGISLSLVAIYISGMYYAFWCHTFLRTLYSTIA--LGMFALAIAVQIP 235
            .:...::|.|.:....:|.....|::..|:.:||.|:.:.|...:::.:.  :|:.|....:...
Yeast   126 KNISLQQHLEHWQKFSYLSNINLLISSQITILYYLFYDYVFFFKIFTLLMNFIGLVAYFFILTDK 190

  Fly   236 RLNVSMNGKVAVLLLWSAYGI-IPLGHWAVAMGGLENELVRLMVPRIVLMYLLCLVAFVFYAAKI 299
            .::.....|....:..|.... :||....:...||||...|:.|..|....:..:.|.:.|..:.
Yeast   191 LISSKRFNKTVFFISVSVVCCSLPLLTAIITFDGLENLKERIKVNAITWELVALVAASIIYVTRF 255

  Fly   300 PERWF--TGKVDFVGHSHNWWHLIIV-AAFYHW 329
            ||..|  ..|.:...||...:||:|. .||||:
Yeast   256 PESLFRRNKKEEGWNHSEYLFHLLISGTAFYHF 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7530NP_650387.1 HlyIII 111..329 CDD:281059 54/226 (24%)
IZH4NP_014540.1 HlyIII 27..298 CDD:413828 55/228 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR20855
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.