DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7530 and IZH1

DIOPT Version :9

Sequence 1:NP_650387.1 Gene:CG7530 / 41784 FlyBaseID:FBgn0038256 Length:351 Species:Drosophila melanogaster
Sequence 2:NP_010780.1 Gene:IZH1 / 852102 SGDID:S000002900 Length:316 Species:Saccharomyces cerevisiae


Alignment Length:266 Identity:80/266 - (30%)
Similarity:129/266 - (48%) Gaps:22/266 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 KFKWLCNFDDAPSHLKFNPYIRRGYRTFLPSTKMCLQSIFWWTNETINIWSHLAGCILF----IG 132
            |.|.|.|||:.|...|.|..|..||.....|.|.||.|:|:|.|||:||::||...|::    |.
Yeast    36 KQKLLHNFDELPEWQKDNDKILTGYVRETLSWKKCLYSLFYWNNETVNIYTHLVPAIVYFVFAIT 100

  Fly   133 LTIFDLQFLRLHASLSDQVLVVCLLVCFCLCMLMSAIYHIFSCKSEEHYELFLSVDFLG----IS 193
            ||.:.|..:....|.||..::...|:....|::.|:.:|.....||:....:..:|:||    ||
Yeast   101 LTNYFLIPVFPSTSWSDYTVINIFLMGAFSCLMCSSCFHCMKQHSEKQSNFWSKLDYLGIISLIS 165

  Fly   194 LSLVAIYISGMYYAFWCHTFLRTLYS--TIALGMFALAIAVQIPRLNVS--MNGKVAVLLLWSAY 254
            .|::.|    :|:.::.|....:|::  |:.|..|. .:.|...:.|.|  ...:....:|:...
Yeast   166 CSMIPI----IYFGYFDHISYFSLFTIVTLVLATFC-TVCVLHDKFNTSTFRPFRAMFFILFGFS 225

  Fly   255 GIIPL--GHWAVAMGGLENELVRLMVPRIVLMYLLCLVAFVFYAAKIPERWFTGKVDFVGHSHNW 317
            |::||  |.:..   |::..|.|:.|..:....|..:...|.|..:|||....||.||.|.||..
Yeast   226 GLLPLTTGFFKF---GIQGVLNRIKVSFVFWEALFYISGAVIYGFRIPETLAPGKFDFFGSSHQI 287

  Fly   318 WHLIIV 323
            :|:::|
Yeast   288 FHIMVV 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7530NP_650387.1 HlyIII 111..329 CDD:281059 63/227 (28%)
IZH1NP_010780.1 HlyIII 75..300 CDD:397239 63/227 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53658
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR20855
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.