powered by:
Protein Alignment CG7530 and AT4G38290
DIOPT Version :9
Sequence 1: | NP_650387.1 |
Gene: | CG7530 / 41784 |
FlyBaseID: | FBgn0038256 |
Length: | 351 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_195542.1 |
Gene: | AT4G38290 / 829986 |
AraportID: | AT4G38290 |
Length: | 108 |
Species: | Arabidopsis thaliana |
Alignment Length: | 64 |
Identity: | 28/64 - (43%) |
Similarity: | 40/64 - (62%) |
Gaps: | 0/64 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 282 VLMYLLCLVAFVFYAAKIPERWFTGKVDFVGHSHNWWHLIIVAAFYHWHNTGLVYAEYRLNNGC 345
:||.||..:..:.||.:|||||..||.|..||||..:|:::||..:..:..||||.::|...||
plant 45 ILMGLLYGLGALVYATRIPERWMPGKFDIAGHSHQLFHVLVVAGAFTHYRAGLVYLKWRDIEGC 108
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG7530 | NP_650387.1 |
HlyIII |
111..329 |
CDD:281059 |
21/46 (46%) |
AT4G38290 | NP_195542.1 |
HlyIII |
<42..93 |
CDD:383485 |
21/47 (45%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG1272 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1524940at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.910 |
|
Return to query results.
Submit another query.