DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7530 and PAQR6

DIOPT Version :10

Sequence 1:NP_650387.1 Gene:CG7530 / 41784 FlyBaseID:FBgn0038256 Length:351 Species:Drosophila melanogaster
Sequence 2:NP_079173.2 Gene:PAQR6 / 79957 HGNCID:30132 Length:351 Species:Homo sapiens


Alignment Length:207 Identity:44/207 - (21%)
Similarity:65/207 - (31%) Gaps:59/207 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   180 HYELFLSVDFLGI-SLSLVAIYISGMYYAFWCHTFLRTLYSTIA---------LGMFALAIAVQI 234
            |...||....|.: ||.....|.:....|.|.|..|...:...|         |..::..:.::.
Human     7 HICYFLDYGALSLYSLGCAFPYAAYSMPASWLHGHLHQFFVPAAALNSFLCTGLSCYSRFLELES 71

  Fly   235 PRLN-VSMNGKVAVLLLWSAYGIIPLGH-----WAVAMG-GLENELVRLMVPRIVLMYLLCLVAF 292
            |.|: |...|..|...|   :..:||.:     |....| |.|    .|.......::...|..|
Human    72 PGLSKVLRTGAFAYPFL---FDNLPLFYRLGLCWGRGHGCGQE----ALSTSHGYHLFCALLTGF 129

  Fly   293 VFYAAKIPERWFTGKVDFVG------------------HSHNWWHLIIVAAFYHWHNTGLVYAEY 339
            :| |:.:|||...|:.|::|                  |..||                .....|
Human   130 LF-ASHLPERLAPGRFDYIGEGTPGPAREEAGADAFPEHRMNW----------------ATATSY 177

  Fly   340 RLNNGCTAPVLS 351
            ..:..|.||..|
Human   178 STSVQCWAPTSS 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7530NP_650387.1 HlyIII 111..329 CDD:427098 39/183 (21%)
PAQR6NP_079173.2 HlyIII <1..150 CDD:470885 36/150 (24%)

Return to query results.
Submit another query.