DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7530 and Paqr4

DIOPT Version :9

Sequence 1:NP_650387.1 Gene:CG7530 / 41784 FlyBaseID:FBgn0038256 Length:351 Species:Drosophila melanogaster
Sequence 2:NP_076313.1 Gene:Paqr4 / 76498 MGIID:1923748 Length:273 Species:Mus musculus


Alignment Length:274 Identity:81/274 - (29%)
Similarity:124/274 - (45%) Gaps:37/274 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 LCNFDDAPSHLKFNPYIRRGYRTFLPSTKMCLQSIFWWTNETINIWSH---LAGCILFIGLTIFD 137
            |.::..:|.||:||.::..|||. ..|...||:|:|:..||..||::|   |.|.::.:.:|:..
Mouse     9 LLDWASSPPHLQFNKFVLTGYRP-ASSGSGCLRSLFYLHNELGNIYTHGLALLGFLVLVPMTMPW 72

  Fly   138 LQFLRLHASLSDQVLVVCLLVCFCLCMLMSAIYHIFSCK--SEEHYELFLSVDFLGISL--SLVA 198
            .| |.....|.....|.||:.     ...|.:||:|.|.  ....|...|::|..|:.|  :|.|
Mouse    73 SQ-LGKDGWLGGTHCVACLVP-----PAASVLYHLFMCHQGGSPVYTRLLALDMCGVCLVNTLGA 131

  Fly   199 IYISGMYYAFWCHTFLR-------TLYSTIALGMFALAIAVQIPRLNVSMNGKVAVLLLWSAYGI 256
            :.|  ::....|..:||       |..|.:| |..||.......||........|.||::.|.|:
Mouse   132 LPI--IHCTLACRPWLRPAALMGYTALSGVA-GWRALTAPSTSARLRAFGWQAGARLLVFGARGV 193

  Fly   257 IPLGHWAVAMGGLENELVRLMVPRIVLMYLLCLVAFVFYAAKIPERWFTGKVDFVGHSHNWWHLI 321
               |..:.|.|.|         |..:.|..|.|:..:...|::||||..|:.|:.|:||...||:
Mouse   194 ---GLGSGAPGSL---------PCYLRMDALALLGGLVNVARLPERWGPGRFDYWGNSHQIMHLL 246

  Fly   322 IVAAFYHWHNTGLV 335
            .|.:....| .|:|
Mouse   247 SVGSILQLH-AGVV 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7530NP_650387.1 HlyIII 111..329 CDD:281059 65/231 (28%)
Paqr4NP_076313.1 HlyIII 43..254 CDD:383485 65/231 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1524940at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.