DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7530 and Paqr9

DIOPT Version :9

Sequence 1:NP_650387.1 Gene:CG7530 / 41784 FlyBaseID:FBgn0038256 Length:351 Species:Drosophila melanogaster
Sequence 2:NP_940806.2 Gene:Paqr9 / 75552 MGIID:1922802 Length:375 Species:Mus musculus


Alignment Length:327 Identity:88/327 - (26%)
Similarity:121/327 - (37%) Gaps:80/327 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 KWLCNFDDAPSHLKFNPYIRRGYRTFLPSTKMCLQSIFWWTNETINIWSHLAGCILFIGLTIFDL 138
            |.|..:|:.|... ...:|..|||....:.:.||.|:...||||:|.|:|      ||.|.:|..
Mouse    40 KPLLRWDEVPDDF-VECFILSGYRRLPCTAQECLASVLKPTNETLNFWTH------FIPLLLFLS 97

  Fly   139 QFLRLHASLSDQVLV--VCLLVCFC------LCMLMSAIYHIFSCKSEEHYELFLSVDFLGISL- 194
            :|.||.......|..  ..||..:|      |...||...|:|||.|......|..:|:..||. 
Mouse    98 KFCRLFFLGGSDVPFHHPWLLPLWCYASGVLLTFAMSCTAHVFSCLSLRLRAAFFYLDYASISYY 162

  Fly   195 ---SLVAIYISGMYYAF--------------------W---CHTFLRTLYSTIALGM-FALAIAV 232
               |.||.|    ||..                    |   | |.|..:|..:.|.: |.||:|.
Mouse   163 GFGSTVAYY----YYLLPSLSLLDARVMTPYVQQRLGWHVDC-TRLIAVYRALVLPVAFVLAVAC 222

  Fly   233 QIPRLNVSMNGKVAVLLLWSAYG--------IIPLG--------HWAVAMGGLENELVRLMVPRI 281
            .:.......:        |.:|.        ::||.        .|...:.| ||..:.:...| 
Mouse   223 TVACCKSRTD--------WCSYPFALRTFVFVMPLSMACPIMLESWLFDLRG-ENPTLFVHFYR- 277

  Fly   282 VLMYLLCLVAFVFYAAKIPERWFTGKVDFVGHSHNWWHLIIVAAFYHWHNTGLVYAEYRLNNGCT 346
              .|...:||..|..:|||||...|..|.:||||..:|:....:.|    ..:.|.|..|.....
Mouse   278 --RYFWLVVAAFFNVSKIPERIQPGLFDIIGHSHQLFHIFTFLSIY----DQVYYVEEGLRQFLQ 336

  Fly   347 AP 348
            ||
Mouse   337 AP 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7530NP_650387.1 HlyIII 111..329 CDD:281059 72/269 (27%)
Paqr9NP_940806.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..39
HlyIII 79..318 CDD:296067 71/261 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1524940at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.