DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7530 and Paqr8

DIOPT Version :9

Sequence 1:NP_650387.1 Gene:CG7530 / 41784 FlyBaseID:FBgn0038256 Length:351 Species:Drosophila melanogaster
Sequence 2:NP_001342051.1 Gene:Paqr8 / 74229 MGIID:1921479 Length:354 Species:Mus musculus


Alignment Length:310 Identity:68/310 - (21%)
Similarity:111/310 - (35%) Gaps:87/310 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 PNILGHGPNYDDKLSKFKWLCNFDDAPSHLKFNPYIRRGYRTFLPSTKMCLQSIFWWTNETINIW 121
            |.||..|      |.|........|.|...: .|||..|||......:....|:|...||.:|:|
Mouse    23 PKILEEG------LPKMPCTVPETDVPQLFR-EPYIHAGYRPTGHEWRYYFFSLFQKHNEVVNVW 80

  Fly   122 SH-LAGCILFIGLTIF----DLQFLRLHASLSDQVLVVCLLVCFCLCMLMSAIYHIFSCKSEEHY 181
            :| ||...:.:....|    .||:...|.  ...:|.:...:.:..|.|::   |:...|||..:
Mouse    81 THLLAALAVLLRFWAFVEAGALQWASPHT--LPLLLFILSSITYLTCSLLA---HLLQSKSELSH 140

  Fly   182 ELFLSVDFLGISLSLVAIYISGMYYA--------FW------------------CHT-------- 212
            ..|..||::|:|:......::..:|:        ||                  |:.        
Mouse   141 YTFYFVDYVGVSVYQYGSALAHFFYSSDQAWYELFWIFFLPAAAFCGWLSCAGCCYAKYRYRRPY 205

  Fly   213 -FLRTLYSTIALGM-FALAIAVQIPRLNVSMNGKVAVLLLWSAYGIIPLGHWAVA---MGGLENE 272
             .:|.:...:..|: |.|.|:                          |:.| .||   :.|.:.:
Mouse   206 PVMRKICQVVPAGLAFVLDIS--------------------------PVAH-RVALCHLAGCQEQ 243

  Fly   273 LVRLMVPRIVLMYLLCLVAFVFYAAKIPERWFTGKVDFVGHSHNWWHLII 322
            .....    .|..|..||:..|::..:||::|.|..|.|||.|..:|..:
Mouse   244 AAWYH----TLQILFFLVSAYFFSCPVPEKYFPGSCDIVGHGHQIFHAFL 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7530NP_650387.1 HlyIII 111..329 CDD:281059 53/256 (21%)
Paqr8NP_001342051.1 HlyIII 70..297 CDD:367292 53/256 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1524940at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.