DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7530 and Paqr7

DIOPT Version :9

Sequence 1:NP_650387.1 Gene:CG7530 / 41784 FlyBaseID:FBgn0038256 Length:351 Species:Drosophila melanogaster
Sequence 2:NP_001272774.1 Gene:Paqr7 / 71904 MGIID:1919154 Length:345 Species:Mus musculus


Alignment Length:269 Identity:65/269 - (24%)
Similarity:111/269 - (41%) Gaps:57/269 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 LKFNPYIRRGYRTFLPSTKMCLQSIFWWTNETINIWSHLAGCILFIGLTIFDLQFLRLHASLSDQ 150
            |.:.|||..|||....:.....:::|...||.:|:|:||...:..:      |:.:.|.||:..:
Mouse    40 LFWKPYIYAGYRPLHQNWCFYFRTLFQRHNEAVNVWTHLLAALALL------LRLIGLAASVDFR 98

  Fly   151 ------VLVVCLLVCFCLCMLMSAIYHIFSCKSE-EHYELFLSVDFLGISLSLVAIYISGMYYAF 208
                  .|...:|..|.. :..||:.|:...||| .||..|. :|::|:::......::..|||.
Mouse    99 EDPHALPLFFIVLASFTY-LSFSAVAHLLQAKSEFWHYSFFF-LDYVGVAVYQFGSALAHFYYAI 161

  Fly   209 ---WCHTFLRTLYSTIALGMFALAIA-------VQIPRLNVSMNGKV---AVLLLWSAYGIIPLG 260
               | |..::.::...|..:..|:.|       .|.|    .:.|::   |...|.....|.|:.
Mouse   162 EPSW-HDKVQAIFLPTAAFLAWLSCAGSCYNKYSQKP----GLLGRIFQEAPSALAYVLDISPVL 221

  Fly   261 HWAVAMGGLENELVRLMVPRI------VLMYLLCLVAF-----VFYAAKIPERWFTGKVDFVGHS 314
            |             |::|..:      .|:|..|.|.|     .|::..:||.||.|.....|..
Mouse   222 H-------------RIIVSPLPAEEDPALLYHKCQVVFFLLAAAFFSTVMPESWFPGSCHIFGQG 273

  Fly   315 HNWWHLIIV 323
            |..:|:.:|
Mouse   274 HQVFHVFLV 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7530NP_650387.1 HlyIII 111..329 CDD:281059 58/244 (24%)
Paqr7NP_001272774.1 HlyIII 65..289 CDD:397239 58/244 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1524940at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.