DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7530 and Paqr6

DIOPT Version :9

Sequence 1:NP_650387.1 Gene:CG7530 / 41784 FlyBaseID:FBgn0038256 Length:351 Species:Drosophila melanogaster
Sequence 2:XP_006502070.3 Gene:Paqr6 / 68957 MGIID:1916207 Length:426 Species:Mus musculus


Alignment Length:325 Identity:84/325 - (25%)
Similarity:118/325 - (36%) Gaps:86/325 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 IRRGYRTFLPSTKMCLQSIFWWTNETINIWSHLAGCILFIGLTIFDLQFLRL-----HASLSDQV 151
            |..|||....|...|:.|.|..||||:|||:|      |:....|..:.|.|     .|......
Mouse    82 IMSGYRCPTSSALDCVLSSFQMTNETVNIWTH------FLPTWYFLWRLLALGSPGFRADPYHLP 140

  Fly   152 LVVCLLVCFCLCMLMSAIYHIFSCKSEEHYELFLSVDFLGISL----SLVAIYISG--------- 203
            |:|.||.. ||....|...|.||..|.....:...:|:..:||    .|.|:.:.|         
Mouse   141 LLVFLLPA-CLYPFASCCAHTFSSMSPRARHICYFLDYGALSLYSLGELRAVGLDGGAEGEPSSL 204

  Fly   204 ----------MYYAF-----WCHTFLRTLY-STIALGMF---ALAIAVQIPRL---NVSMNGKVA 246
                      .|.|:     |.|:.|..|: ...||..|   .|:...:.|.|   ..|...:.|
Mouse   205 SSHLATGCAFPYAAYSMPASWLHSRLHQLFVPAAALNSFLCTGLSCYSRFPELEYPGFSKALRTA 269

  Fly   247 VLLLWSAYGIIPLGH-----WAVAMGGLENELVRLMVPRIVL-----MYLLC-LVAFVFYAAKIP 300
            .......:..:||.:     |    ||..:      ..|..|     .:||| |::...:||::|
Mouse   270 AFAYPFLFDNLPLFYRLRLCW----GGAHS------CGRDALSSNHGYHLLCALLSGFLFAARLP 324

  Fly   301 ERWFTGKVDFVGHSHNWWHLIIVAAFYH--------------WHNTGLVYAEYRLNNGCTAPVLS 351
            ||...|:.|::||||..:|:..|...:.              |    |...|..|..|.|...||
Mouse   325 ERLAPGRFDYIGHSHQLFHICAVLGTHFQLEAVLADMGSRRAW----LAVQEPTLGLGATVATLS 385

  Fly   352  351
            Mouse   386  385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7530NP_650387.1 HlyIII 111..329 CDD:281059 69/282 (24%)
Paqr6XP_006502070.3 HlyIII 101..354 CDD:367292 69/269 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1524940at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.