DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7530 and Mmd

DIOPT Version :9

Sequence 1:NP_650387.1 Gene:CG7530 / 41784 FlyBaseID:FBgn0038256 Length:351 Species:Drosophila melanogaster
Sequence 2:NP_001382352.1 Gene:Mmd / 67468 MGIID:1914718 Length:239 Species:Mus musculus


Alignment Length:228 Identity:54/228 - (23%)
Similarity:83/228 - (36%) Gaps:73/228 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 WTNETINIWSHLAG-CILFIGLTIFDL-QFLRLHASLSDQVLVVCLLVCFCLCMLMSAIYHIFSC 175
            |  |.|..|.:..| |.|||..|:|.: .:.:.|....:.        ||.:|..|  :.:.|..
Mouse    58 W--EKITAWIYGMGLCALFIVSTVFHIVSWKKSHLRTVEH--------CFHMCDRM--VIYFFIA 110

  Fly   176 KSEEHYELFLSVDFLGISLSLVAIYI-----SGMYYAFWCHTFLRT--LYSTIALGMFALAIAVQ 233
            .|   |..:|::..||...|.:..:|     .|..|.|..|...:.  |:..:.:| |:.|:.| 
Mouse   111 AS---YAPWLNLRELGPLASHMRWFIWLMAAGGTIYVFLYHEKYKVVELFFYLTMG-FSPALVV- 170

  Fly   234 IPRLNVSMNGKVAVLLLWSAYGIIPLGHWAVAMGGLENELVRLMVPRIVLMYLLCLVAFVFYAAK 298
                 .|||...              |...:|.|||                :.|| ..||:.: 
Mouse   171 -----TSMNNTD--------------GLQELACGGL----------------IYCL-GVVFFKS- 198

  Fly   299 IPERWFTGKVDFVGHSHNWWHLII-VAAFYHWH 330
                  .|.:.|   :|..|||.: .||..|::
Mouse   199 ------DGIIPF---AHAIWHLFVATAAAVHYY 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7530NP_650387.1 HlyIII 111..329 CDD:281059 53/225 (24%)
MmdNP_001382352.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.