DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7530 and mmd

DIOPT Version :9

Sequence 1:NP_650387.1 Gene:CG7530 / 41784 FlyBaseID:FBgn0038256 Length:351 Species:Drosophila melanogaster
Sequence 2:NP_001032496.1 Gene:mmd / 641478 ZFINID:ZDB-GENE-051120-39 Length:239 Species:Danio rerio


Alignment Length:246 Identity:57/246 - (23%)
Similarity:85/246 - (34%) Gaps:86/246 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 WSHLAGCI--------LFIGLTIFDLQFLRLHASLSDQ--------VLVVCLLVCFCLCMLMSAI 169
            :.|.|.|.        .|:|:.:       || .|||.        |..:.|:..|    |:|.:
Zfish    26 YEHAANCYTHALLITPAFVGMAL-------LH-RLSDDRWERFTAWVYGMGLIALF----LVSTV 78

  Fly   170 YHIFSCKSE-----EHYELFLSVDFLGISLSLVAIYISGMYYAFWCHTFLRTLYSTIALGM---- 225
            :||.|.|..     ||  .|...|.:.|...:.|.|.:      |.:  ||.| ..:|..|    
Zfish    79 FHIISWKKSHMRTMEH--CFHMCDRVVIYFFIAASYTT------WLN--LREL-GPLAAHMRWFV 132

  Fly   226 FALAIAVQIPRLNVSMNGKVAVLLLWSAYGIIPL----------GHWAVAMGGLENELVRLMVPR 280
            :.:|.|..|...|.....|:..|:.:...|..|.          |...:|.|||           
Zfish   133 WLMAAAGTIYVFNYHEKYKLVELMFYLTMGFFPALVVTSTTNTEGLSELAFGGL----------- 186

  Fly   281 IVLMYLLCLVAFVFYAAKIPERWFTGKVDFVGHSHNWWHLII-VAAFYHWH 330
                 :.||..|.|..        .|.:.|   :|..||:.: :||..|::
Zfish   187 -----VYCLGVFFFKC--------DGVIPF---AHAIWHVFVALAAAIHYY 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7530NP_650387.1 HlyIII 111..329 CDD:281059 56/243 (23%)
mmdNP_001032496.1 hlyIII 27..227 CDD:273425 57/245 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.