DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7530 and paqr6

DIOPT Version :9

Sequence 1:NP_650387.1 Gene:CG7530 / 41784 FlyBaseID:FBgn0038256 Length:351 Species:Drosophila melanogaster
Sequence 2:XP_017207045.1 Gene:paqr6 / 570587 ZFINID:ZDB-GENE-090714-1 Length:402 Species:Danio rerio


Alignment Length:258 Identity:69/258 - (26%)
Similarity:111/258 - (43%) Gaps:44/258 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 IRRGYRTFLPSTKMCLQSIFWWTNETINIWSHLAGCILFIGLTIFDLQFLRLHASL---SDQ--- 150
            |..|||....|...|:.|.|..||||:|||:|      |:....|..:|..|.:||   :|.   
Zfish    94 IMSGYRHPRSSALDCILSSFQMTNETVNIWTH------FLPTWYFLWRFSVLCSSLDFVTDSYTW 152

  Fly   151 -VLVVCLLVCFCLCMLMSAIYHIFSCKSEEHYELFLSVDFLGISLSLVAIYISGMYYAF---WCH 211
             :||..||:  ||....|:..|.||..|.|...:....|:..:||..:...||...||.   |.:
Zfish   153 PLLVYMLLI--CLYPFTSSCAHTFSTMSAEARHICYFFDYGALSLYSLGCAISYGSYAMPDSWVN 215

  Fly   212 TFLRTLYSTI---------ALGMFALAIAVQIP-RLNVSMNGKVAVLLLWSAYGIIPLGH----- 261
            ::|...:.||         ::..:...|.:|.| :..:.......|..|:.::   ||.:     
Zfish   216 SWLHQHFVTIGICNSLFCTSMSCYTRFIELQFPHKSKILRTSAFVVPFLFDSF---PLFYRLLSC 277

  Fly   262 -WAVAMGGLENELVRLMVPRIVLMYLLCLVAFVFYAAKIPERWFTGKVDFVGHSHNWWHLIIV 323
             |....   .:|.:......::..:|.|.:    :|:.:|||...|:.|::||||..:|:..|
Zfish   278 CWGSCS---PSEALASHSYHLLFAFLTCFL----FASHLPERLAPGRFDYIGHSHQLFHICAV 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7530NP_650387.1 HlyIII 111..329 CDD:281059 62/239 (26%)
paqr6XP_017207045.1 HlyIII 113..340 CDD:281059 62/239 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1524940at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.