DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7530 and paqr4a

DIOPT Version :9

Sequence 1:NP_650387.1 Gene:CG7530 / 41784 FlyBaseID:FBgn0038256 Length:351 Species:Drosophila melanogaster
Sequence 2:NP_001314992.1 Gene:paqr4a / 568196 ZFINID:ZDB-GENE-131127-110 Length:272 Species:Danio rerio


Alignment Length:273 Identity:74/273 - (27%)
Similarity:125/273 - (45%) Gaps:45/273 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 LCNFDDAPSHLKFNPYIRRGYRTFLPSTKMCLQSIFWWTNETINIWSHLAGCILFIGLTIFDLQF 140
            |.::.::|.||:||.|:..|||. :.:.:.|::|:|:..||..||::|....:.|:.|...::.:
Zfish     9 LLDWANSPPHLQFNKYVLTGYRP-ISTVQECIKSLFYLHNELGNIYTHGIPLLCFLVLLPLNIPW 72

  Fly   141 LRLHASLSDQVLVVCL-LVCFCLCM---LMSAIYHIFSCK--SEEHYELFLSVDFLGISL--SLV 197
                    .|:.|..| :|.|..|:   |.|.:||:|...  .|..|:..|::|..||.:  :|.
Zfish    73 --------SQISVTWLGVVHFLACLSPQLGSVVYHLFMNHEGGEPVYKTLLTLDMCGICMINTLG 129

  Fly   198 AIYISGMYYAFWCHTFLRT--LYSTIALGMFALAIAV----QIPRLNVSMNGKVAVLLLWSA--- 253
            |:.|  :|....|:.|.||  |...|.|..:|:..|:    ::.||.         ...|.|   
Zfish   130 ALPI--VYSTLLCYPFTRTVALLMYILLSSYAIYCAITARSRVRRLR---------SFAWQALFR 183

  Fly   254 YGIIPLGHWAVAMGGLENELVRLMVPRIVLMYLLCLVAFVFYAAKIPERWFTGKVDFVGHSHNWW 318
            :....| .|....||....|...:.     |..|.::..|....:||||:..|..|:..:||...
Zfish   184 FSFFLL-RWVGVGGGSPTSLRHFLT-----MDALAVLGGVINITRIPERFRPGLFDYWCNSHQIM 242

  Fly   319 HLIIVAA--FYHW 329
            |:::|.:  :.||
Zfish   243 HVLVVVSILYLHW 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7530NP_650387.1 HlyIII 111..329 CDD:281059 60/236 (25%)
paqr4aNP_001314992.1 HlyIII 43..252 CDD:322438 60/233 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1524940at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.