DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7530 and PAQR5

DIOPT Version :9

Sequence 1:NP_650387.1 Gene:CG7530 / 41784 FlyBaseID:FBgn0038256 Length:351 Species:Drosophila melanogaster
Sequence 2:NP_001098024.1 Gene:PAQR5 / 54852 HGNCID:29645 Length:330 Species:Homo sapiens


Alignment Length:254 Identity:69/254 - (27%)
Similarity:116/254 - (45%) Gaps:39/254 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 GYRTFLPSTKMCLQSIFWWTNETINIWSHLAGCILF-----IGLTIFDLQFLRLHASLSDQVLVV 154
            |||....|...|:.|:|..||||:|||:||.....|     ..|.:.|::    :.|.|..:|| 
Human    27 GYRHPQSSATACILSLFQMTNETLNIWTHLLPFWFFAWRFVTALYMTDIK----NDSYSWPMLV- 86

  Fly   155 CLLVCFCLCMLMSAIYHIFSCKSEEHYELFLSVDFLGISLSLVAIYISGMYYAF----WCHTF-- 213
             .:...|:..|:|:..|.||..|:....:...:|:..::|..:...|:...|.|    .|.||  
Human    87 -YMCTSCVYPLVSSCAHTFSSMSKNARHICYFLDYGAVNLFSLGSAIAYSAYTFPDALMCTTFHD 150

  Fly   214 -------LRTLYSTIALGMFALAIAVQIPRLNVSMNGKVAVLLLWS---AYGIIPLGHWAVAMGG 268
                   |.|:.|| .|..::..:.:|.|||     .||..:|.::   .:..:|:.:......|
Human   151 YYVALAVLNTILST-GLSCYSRFLEIQKPRL-----CKVIRVLAFAYPYTWDSLPIFYRLFLFPG 209

  Fly   269 --LENELVRLMVPRIVLMYLLCLVAFVFYAAKIPERWFTGKVDFVGHSHNWWHLIIVAA 325
              .:||........::    :.|:|...|:|.:|||...|:.|::||||..:|:.::.|
Human   210 ESAQNEATSYHQKHMI----MTLLASFLYSAHLPERLAPGRFDYIGHSHQLFHVCVILA 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7530NP_650387.1 HlyIII 111..329 CDD:281059 63/238 (26%)
PAQR5NP_001098024.1 HlyIII 43..269 CDD:308575 63/238 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1524940at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.