DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7530 and paqr7b

DIOPT Version :9

Sequence 1:NP_650387.1 Gene:CG7530 / 41784 FlyBaseID:FBgn0038256 Length:351 Species:Drosophila melanogaster
Sequence 2:NP_899188.1 Gene:paqr7b / 368256 ZFINID:ZDB-GENE-030728-2 Length:354 Species:Danio rerio


Alignment Length:270 Identity:65/270 - (24%)
Similarity:111/270 - (41%) Gaps:65/270 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 YIRRGYRTFLPSTKMCLQSIFWWTNETINIWSHLAGCILFIGLTIFD-----LQFLR-LHASLSD 149
            :|..|||....:.:....::|...||::|:|:||...::.  |..|.     :.||| .||    
Zfish    50 HIITGYRPPDQNWRYYFLTLFQRHNESVNVWTHLLASLII--LVKFQELSETVDFLRDPHA---- 108

  Fly   150 QVLVVCLLVCFCL--CMLMSAIYHIFSCKSEEHYELFLSVDFLGISLSLVAIYISGMYYAF---W 209
            |.:.:.||..|..  |   ||:.|:.|.|||..:..|..:|::|:::......::..||..   |
Zfish   109 QPMFILLLAAFTYLGC---SALAHLLSAKSEISHYTFYFLDYVGVAVYQYGSALAHFYYVVEEEW 170

  Fly   210 CHTFLRTLY------------STIALGMFALAIAVQIPR-----LNVSMNGKVAVL----LLWSA 253
             |..:||.:            :....|.:|   :.::|:     ..|..:|....|    :|...
Zfish   171 -HAQVRTFFLPASAFLAWLSCTGCCYGKYA---SPKLPKFVHKLFQVVPSGLAYCLDISPVLHRI 231

  Fly   254 YGIIPLGHWAVAMGGLENELVRLMVPRIVLMY-----LLCLVAFVFYAAKIPERWFTGKVDFVGH 313
            |......||....               .::|     |..|::..|::...|||||.|:.||:|.
Zfish   232 YRCYSSEHWCADQ---------------AVVYHCYQVLFFLISAYFFSYPHPERWFPGRCDFIGQ 281

  Fly   314 SHNWWHLIIV 323
            .|..:|:.:|
Zfish   282 GHQIFHVFLV 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7530NP_650387.1 HlyIII 111..329 CDD:281059 61/250 (24%)
paqr7bNP_899188.1 HlyIII 70..298 CDD:281059 61/250 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1524940at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.