DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7530 and Paqr9

DIOPT Version :9

Sequence 1:NP_650387.1 Gene:CG7530 / 41784 FlyBaseID:FBgn0038256 Length:351 Species:Drosophila melanogaster
Sequence 2:NP_001258081.2 Gene:Paqr9 / 315904 RGDID:1311515 Length:373 Species:Rattus norvegicus


Alignment Length:327 Identity:88/327 - (26%)
Similarity:121/327 - (37%) Gaps:80/327 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 KWLCNFDDAPSHLKFNPYIRRGYRTFLPSTKMCLQSIFWWTNETINIWSHLAGCILFIGLTIFDL 138
            |.|..:|:.|... ...:|..|||....:.:.||.|:...||||:|.|:|      ||.|.:|..
  Rat    38 KPLLRWDEVPDDF-VECFILSGYRRLPCTAQECLASVLKPTNETLNFWTH------FIPLLLFLS 95

  Fly   139 QFLRLHASLSDQVLV--VCLLVCFC------LCMLMSAIYHIFSCKSEEHYELFLSVDFLGISL- 194
            :|.||.......|..  ..||..:|      |...||...|:|||.|......|..:|:..||. 
  Rat    96 KFCRLFFLGGSDVPFHHPWLLPLWCYASGVLLTFAMSCTAHVFSCLSLRLRAAFFYLDYASISYY 160

  Fly   195 ---SLVAIYISGMYYAF--------------------W---CHTFLRTLYSTIALGM-FALAIAV 232
               |.||.|    ||..                    |   | |.|..:|..:.|.: |.||:|.
  Rat   161 GFGSTVAYY----YYLLPSLSLLDARVMTPYVQQRLGWHVDC-TRLIAVYRALVLPVAFVLAVAC 220

  Fly   233 QIPRLNVSMNGKVAVLLLWSAYG--------IIPLG--------HWAVAMGGLENELVRLMVPRI 281
            .:.......:        |.:|.        ::||.        .|...:.| ||..:.:...| 
  Rat   221 TVACCKSRTD--------WCSYPFALRTFVFVMPLSMACPIMLESWLFDLRG-ENPTLFVHFYR- 275

  Fly   282 VLMYLLCLVAFVFYAAKIPERWFTGKVDFVGHSHNWWHLIIVAAFYHWHNTGLVYAEYRLNNGCT 346
              .|...:||..|..:|||||...|..|.:||||..:|:....:.|    ..:.|.|..|.....
  Rat   276 --RYFWLVVAAFFNVSKIPERIQPGLFDIIGHSHQLFHIFTFLSIY----DQVYYVEEGLRQFLQ 334

  Fly   347 AP 348
            ||
  Rat   335 AP 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7530NP_650387.1 HlyIII 111..329 CDD:281059 72/269 (27%)
Paqr9NP_001258081.2 HlyIII 77..316 CDD:413828 71/261 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1524940at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.