DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7530 and Paqr5

DIOPT Version :9

Sequence 1:NP_650387.1 Gene:CG7530 / 41784 FlyBaseID:FBgn0038256 Length:351 Species:Drosophila melanogaster
Sequence 2:NP_001014114.1 Gene:Paqr5 / 315741 RGDID:1311259 Length:330 Species:Rattus norvegicus


Alignment Length:259 Identity:71/259 - (27%)
Similarity:118/259 - (45%) Gaps:49/259 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 GYRTFLPSTKMCLQSIFWWTNETINIWSHLAGCILFI-----GLTIFDLQFLRLHASLSDQVLVV 154
            |||....|...|:.|:|..||||:|||:||.....|:     .|.:.|:|    :.|.|..:|| 
  Rat    27 GYRHPQSSATACILSLFQMTNETLNIWTHLLPFWFFMWRFMTALYMTDIQ----NDSYSWPLLV- 86

  Fly   155 CLLVCFCLCMLMSAIYHIFSCKSEEHYELFLSVDFLGISLSLVAIYISGMYYAF----WCHTF-- 213
             .:...|:..|.|:..|.||..|:....:...:|:..::|..:...|:...|.|    .|.||  
  Rat    87 -YMCTSCVYPLASSCAHTFSSMSKNARHICYFLDYGAVNLFSLGSAIAYSAYTFPDALVCSTFHE 150

  Fly   214 -------LRTLYSTIALGMFALAIAVQIPRLNVSMNGKVAVLLLWS---AYGIIPLGHWAVAMGG 268
                   |.|:.|| .|..::..:.:|.|||     .|:..:|.::   |:..:|:.:......|
  Rat   151 CYVALAVLNTILST-GLSCYSRFLELQKPRL-----CKLLRVLAFAYPYAWDSLPIFYRLFLFPG 209

  Fly   269 --LENELVRLMVPRIVLMY-----LLCLVAFVFYAAKIPERWFTGKVDFVGHSHNWWHLIIVAA 325
              ..||         .::|     ::.|:|...|:|.:|||...|:.|::||||..:|:.::.|
  Rat   210 ESSRNE---------AMLYHQKHMVMTLLASFLYSAHLPERLAPGRFDYIGHSHQLFHVCVILA 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7530NP_650387.1 HlyIII 111..329 CDD:281059 65/243 (27%)
Paqr5NP_001014114.1 HlyIII 43..269 CDD:281059 65/243 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1524940at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.