DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7530 and Paqr7

DIOPT Version :9

Sequence 1:NP_650387.1 Gene:CG7530 / 41784 FlyBaseID:FBgn0038256 Length:351 Species:Drosophila melanogaster
Sequence 2:XP_038965971.1 Gene:Paqr7 / 313615 RGDID:1563621 Length:355 Species:Rattus norvegicus


Alignment Length:287 Identity:68/287 - (23%)
Similarity:115/287 - (40%) Gaps:59/287 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 LKFNPYIRRGYRTFLPSTKMCLQSIFWWTNETINIWSHLAGCILFIGLTIFDLQFLRLHASLS-- 148
            |.:.|||..|||....:.....:::|...||.:|:|:||...:..:      |:.:.|..|:.  
  Rat    50 LFWKPYIYAGYRPLHQNWCFYFRTLFQQHNEAVNVWTHLLAALALL------LRLIVLAGSVDFW 108

  Fly   149 ----DQVLVVCLLVCFCLCMLMSAIYHIFSCKSE-EHYELFLSVDFLGISLSLVAIYISGMYYAF 208
                ...|.:.:|..|.. :..||:.|:...||| .||..|. :|::|:::......::..|||.
  Rat   109 EDPHALPLFIIVLASFTY-LSFSALAHLLQAKSEFWHYSFFF-LDYVGVAVYQFGSALAHFYYAI 171

  Fly   209 ---WCHTFLRTLYSTIALGMFALAIA-------VQIPRLNVSMNGKVAVLLLWSAYGIIPLGHWA 263
               | |..::.::...|..:..|:.|       .|.|.|......:|...|.: |..|.|:.|  
  Rat   172 EPSW-HDKVQAIFLPTAAFLAWLSCAGSCYNKYSQKPGLLGRSFQEVPSALAY-ALDISPVVH-- 232

  Fly   264 VAMGGLENELVRLMVPRI------VLMYLLCLVAF-----VFYAAKIPERWFTGKVDFVGHSHNW 317
                       |::|..:      .|:|..|.|.|     .|::..:||.||.|.....|..|..
  Rat   233 -----------RIIVSPLPAEEDPALLYHKCQVVFFLLAAAFFSTVMPESWFPGSCHIFGQGHQV 286

  Fly   318 WHLIIV--------AAFYHWHNTGLVY 336
            :|:.:|        |....:...|.:|
  Rat   287 FHVFLVLCTLAQLEAVTLDYQARGAIY 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7530NP_650387.1 HlyIII 111..329 CDD:281059 59/253 (23%)
Paqr7XP_038965971.1 HlyIII 75..299 CDD:397239 58/246 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1524940at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.