DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7530 and Mmd2

DIOPT Version :9

Sequence 1:NP_650387.1 Gene:CG7530 / 41784 FlyBaseID:FBgn0038256 Length:351 Species:Drosophila melanogaster
Sequence 2:NP_001032294.1 Gene:Mmd2 / 304301 RGDID:1306506 Length:247 Species:Rattus norvegicus


Alignment Length:302 Identity:66/302 - (21%)
Similarity:101/302 - (33%) Gaps:105/302 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 DDKLSKFKWLCNFDDAPSHLKFNPYIRRGYRTFLPSTKMCLQSIFW------------------W 113
            |.:.:|:....| |..|:|.::.|       |.......|....||                  |
  Rat     9 DFQKTKYARFMN-DRVPAHKRYRP-------TEYEHAANCATHAFWIIPSILGSSNLYFLSDDDW 65

  Fly   114 TNETINIWSHLAG-CILFIGLTIF-DLQFLRLHASLSDQVLVVCLLVCFCLCMLMSAIYHIFSCK 176
              |||:.|.:..| |.||:..||| .:.:.:.|..:.:.          ||.|:...:.:.|...
  Rat    66 --ETISAWIYGLGLCGLFVVSTIFHTVSWKKSHLRMVEH----------CLHMIDRMVIYFFIAA 118

  Fly   177 SEEHYELFLSVDFLGISLS----LVAIYIS-GMYYAFWCHT--FLRTLYSTIALGMFALAIAVQI 234
            |   |..:|::..||...|    ||.|..| |..|.|:.|.  .|..|...:.:|.|...:.:.:
  Rat   119 S---YAPWLNLRELGPWASHMRWLVWIMASIGTVYVFFFHERYKLVELLCYVVMGFFPALVILSM 180

  Fly   235 PRLNVSMNGKVAVLLLWSAYGIIPLGHWAVAMGGLENELVRLMVPRIVLMYLLCLVAFVFYAAKI 299
            |...                     |.|.:..||.                ..|| ..||:.:  
  Rat   181 PNTE---------------------GIWELMTGGA----------------FYCL-GMVFFKS-- 205

  Fly   300 PERWFTGKVDFVGHSHNWWHLIIV-AAFYHWHNTGLVYAEYR 340
                 .|::.|   :|..|||.:. .|..|:      ||.:|
  Rat   206 -----DGRIPF---AHAIWHLFVAFGAGTHY------YAIWR 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7530NP_650387.1 HlyIII 111..329 CDD:281059 53/245 (22%)
Mmd2NP_001032294.1 HlyIII 35..235 CDD:413828 58/268 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.