DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7530 and Paqr4

DIOPT Version :9

Sequence 1:NP_650387.1 Gene:CG7530 / 41784 FlyBaseID:FBgn0038256 Length:351 Species:Drosophila melanogaster
Sequence 2:NP_001017377.1 Gene:Paqr4 / 302967 RGDID:1309533 Length:273 Species:Rattus norvegicus


Alignment Length:274 Identity:81/274 - (29%)
Similarity:123/274 - (44%) Gaps:37/274 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 LCNFDDAPSHLKFNPYIRRGYRTFLPSTKMCLQSIFWWTNETINIWSH---LAGCILFIGLTIFD 137
            |.::..:|.||:||.::..|||. ..|...||:|:|:..||..||::|   |.|.::.:.:|:..
  Rat     9 LLDWASSPPHLQFNKFVLTGYRP-ASSGSGCLRSLFYLHNELGNIYTHGLALLGFLVLVPMTMPW 72

  Fly   138 LQFLRLHASLSDQVLVVCLLVCFCLCMLMSAIYHIFSCK--SEEHYELFLSVDFLGISL--SLVA 198
            .| |.....|.....|.||..     ...|.:||:|.|.  ....|...|::|..|:.|  :|.|
  Rat    73 SQ-LGKDGWLGGTHCVACLAP-----PAASVLYHLFMCHQGGSPVYTRLLALDMCGVCLVNTLGA 131

  Fly   199 IYISGMYYAFWCHTFLR-------TLYSTIALGMFALAIAVQIPRLNVSMNGKVAVLLLWSAYGI 256
            :.|  ::....|..:||       |..|.:| |..||.......||........|.||::.|.|:
  Rat   132 LPI--IHCTLACRPWLRPAALMGYTALSGVA-GWRALTAPSTSARLRAFGWQAGARLLVFGARGV 193

  Fly   257 IPLGHWAVAMGGLENELVRLMVPRIVLMYLLCLVAFVFYAAKIPERWFTGKVDFVGHSHNWWHLI 321
               |..:.|.|.|         |..:.|..|.|:..:...|::||||..|:.|:.|:||...||:
  Rat   194 ---GLGSGAPGSL---------PCYLRMDALALLGGLVNVARLPERWGPGRFDYWGNSHQIMHLL 246

  Fly   322 IVAAFYHWHNTGLV 335
            .|.:....| .|:|
  Rat   247 SVGSILQLH-AGVV 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7530NP_650387.1 HlyIII 111..329 CDD:281059 65/231 (28%)
Paqr4NP_001017377.1 HlyIII 43..254 CDD:413828 65/231 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1524940at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.