DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7530 and MMD

DIOPT Version :9

Sequence 1:NP_650387.1 Gene:CG7530 / 41784 FlyBaseID:FBgn0038256 Length:351 Species:Drosophila melanogaster
Sequence 2:XP_006721858.1 Gene:MMD / 23531 HGNCID:7153 Length:269 Species:Homo sapiens


Alignment Length:253 Identity:52/253 - (20%)
Similarity:85/253 - (33%) Gaps:69/253 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 WSHLAGC----ILFIGLTIFDLQFLRLHASLSDQVLVVCLLVCFCLCMLMSAIYHIFSCKSE--- 178
            :.|.|.|    .|.:...:......||.....:::......:..|...::|.::||.|.|..   
Human    26 YEHAANCYTHAFLIVPAIVGSALLHRLSDDCWEKITAWIYGMGLCALFIVSTVFHIVSWKKSHLR 90

  Fly   179 --EHYELFLSVDFLGISLSLVAIYISGMYYAFWCHTFLRTLYSTI----ALGMFALAIAVQIPRL 237
              ||  .|...|.:.|...:.|.|....:...:....|...:|.|    .|..|.|.      .|
Human    91 TVEH--CFHMCDRMVIYFFIAASYAPWFFSLRFVSNLLPNTWSEIKGQAVLTSFCLI------GL 147

  Fly   238 NVSMNGKVAVLLLWSAYGIIPLGHWAVAMGG-----LENELVRLM----------VPRIV----- 282
            |:...|.:|..:.|..        |.:|.||     |.:|..:::          .|.:|     
Human   148 NLRELGPLASHMRWFI--------WLMAAGGTIYVFLYHEKYKVVELFFYLTMGFSPALVVTSMN 204

  Fly   283 ----LMYLLC-----LVAFVFYAAKIPERWFTGKVDFVGHSHNWWHLII-VAAFYHWH 330
                |..|.|     .:..||:.:       .|.:.|   :|..|||.: .||..|::
Human   205 NTDGLQELACGGLIYCLGVVFFKS-------DGIIPF---AHAIWHLFVATAAAVHYY 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7530NP_650387.1 HlyIII 111..329 CDD:281059 51/250 (20%)
MMDXP_006721858.1 hlyIII 27..258 CDD:273425 52/252 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.