DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7530 and Paqr3

DIOPT Version :9

Sequence 1:NP_650387.1 Gene:CG7530 / 41784 FlyBaseID:FBgn0038256 Length:351 Species:Drosophila melanogaster
Sequence 2:NP_001346839.1 Gene:Paqr3 / 231474 MGIID:2679683 Length:311 Species:Mus musculus


Alignment Length:286 Identity:107/286 - (37%)
Similarity:169/286 - (59%) Gaps:27/286 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 LCNFDDAPSHLKFNPYIRRGYRTFLPSTKMCLQSIFWWTNETINIWSHLAGCILFIGLTIFDLQF 140
            |..::..|..||.||||..|||.:||| ::|::|:|..:|||:||||||.|..||..|.|:|:..
Mouse    30 LYTYEQIPVSLKDNPYITDGYRAYLPS-RLCIKSLFILSNETVNIWSHLLGFFLFFTLGIYDMTS 93

  Fly   141 LRLHASLSDQVLVVC--LLVCFCLCMLMSAIYHIFSC-KSEEHYELFLSVDFLGISLSLVAIYIS 202
            :...||.|.:..|:|  .|.||.:|||.|..||:||| :||:....::::|:.|||:.::..|:|
Mouse    94 VLPSASASREDFVICSICLFCFQVCMLCSVGYHLFSCHRSEKTCRRWMALDYAGISIGILGCYVS 158

  Fly   203 GMYYAFWCHTFLRTLYSTIALGMFALAIAVQI-------------PRLNVSMNGKVAVLLLWSAY 254
            |::|||:|:.:.|.:|....|.|.......||             |.:..|::|          |
Mouse   159 GVFYAFYCNNYWRQVYLITVLAMILAVFFAQIHPSYLTQQWQRLRPIIFCSVSG----------Y 213

  Fly   255 GIIPLGHWAVAMGGLENELVRLMVPRIVLMYLLCLVAFVFYAAKIPERWFTGKVDFVGHSHNWWH 319
            |:||..||....||:...:|:...||:::||::.|:||:||.:|:|||:|.|:::::|.||..||
Mouse   214 GVIPTLHWVWLNGGVSAPIVQDFAPRVIVMYVIALLAFLFYISKVPERYFPGQLNYLGSSHQIWH 278

  Fly   320 LIIVAAFYHWHNTGLVYAEYRLNNGC 345
            ::.|...|.||.:.:...:||.:..|
Mouse   279 VLAVVMLYWWHQSTVYVMQYRHSKPC 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7530NP_650387.1 HlyIII 111..329 CDD:281059 86/233 (37%)
Paqr3NP_001346839.1 Golgi targeting. /evidence=ECO:0000250 61..71 4/9 (44%)
HlyIII 64..283 CDD:367292 84/228 (37%)
Golgi targeting. /evidence=ECO:0000250 299..303 1/3 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167837099
Domainoid 1 1.000 170 1.000 Domainoid score I3780
eggNOG 1 0.900 - - E1_COG1272
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H71077
Inparanoid 1 1.050 218 1.000 Inparanoid score I3578
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53658
OrthoDB 1 1.010 - - D1524940at2759
OrthoFinder 1 1.000 - - FOG0005518
OrthoInspector 1 1.000 - - oto92340
orthoMCL 1 0.900 - - OOG6_106474
Panther 1 1.100 - - LDO PTHR20855
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4360
SonicParanoid 1 1.000 - - X3936
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1615.800

Return to query results.
Submit another query.