DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7530 and PAQR3

DIOPT Version :9

Sequence 1:NP_650387.1 Gene:CG7530 / 41784 FlyBaseID:FBgn0038256 Length:351 Species:Drosophila melanogaster
Sequence 2:NP_001035292.1 Gene:PAQR3 / 152559 HGNCID:30130 Length:311 Species:Homo sapiens


Alignment Length:276 Identity:106/276 - (38%)
Similarity:169/276 - (61%) Gaps:7/276 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 LCNFDDAPSHLKFNPYIRRGYRTFLPSTKMCLQSIFWWTNETINIWSHLAGCILFIGLTIFDLQF 140
            |..::..|..||.||||..|||.:||| ::|::|:|..:|||:||||||.|..||..|.|:|:..
Human    30 LYTYEQIPGSLKDNPYITDGYRAYLPS-RLCIKSLFILSNETVNIWSHLLGFFLFFTLGIYDMTS 93

  Fly   141 LRLHASLSDQVLVVC--LLVCFCLCMLMSAIYHIFSC-KSEEHYELFLSVDFLGISLSLVAIYIS 202
            :...||.|.:..|:|  .|.||.:|||.|..||:||| :||:....::::|:.|||:.::..|:|
Human    94 VLPSASASREDFVICSICLFCFQVCMLCSVGYHLFSCHRSEKTCRRWMALDYAGISIGILGCYVS 158

  Fly   203 GMYYAFWCHTFLRTLYSTIALGMFALAIAVQI-PRLNVSMNGKVAVLLLW--SAYGIIPLGHWAV 264
            |::|||:|:.:.|.:|....|.|.......|| |........::..::..  |.||:||..||..
Human   159 GVFYAFYCNNYWRQVYLITVLAMILAVFFAQIHPNYLTQQWQRLRSIIFCSVSGYGVIPTLHWVW 223

  Fly   265 AMGGLENELVRLMVPRIVLMYLLCLVAFVFYAAKIPERWFTGKVDFVGHSHNWWHLIIVAAFYHW 329
            ..||:...:|:...||:::||::.|:||:||.:|:|||:|.|:::::|.||..||::.|...|.|
Human   224 LNGGIGAPIVQDFAPRVIVMYMIALLAFLFYISKVPERYFPGQLNYLGSSHQIWHILAVVMLYWW 288

  Fly   330 HNTGLVYAEYRLNNGC 345
            |.:.:...:||.:..|
Human   289 HQSTVYVMQYRHSKPC 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7530NP_650387.1 HlyIII 111..329 CDD:281059 85/223 (38%)
PAQR3NP_001035292.1 Golgi targeting 61..71 4/9 (44%)
HlyIII 64..283 CDD:308575 83/218 (38%)
Golgi targeting 299..303 1/3 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165147155
Domainoid 1 1.000 171 1.000 Domainoid score I3754
eggNOG 1 0.900 - - E1_COG1272
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H71077
Inparanoid 1 1.050 219 1.000 Inparanoid score I3583
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53658
OrthoDB 1 1.010 - - D1524940at2759
OrthoFinder 1 1.000 - - FOG0005518
OrthoInspector 1 1.000 - - oto88774
orthoMCL 1 0.900 - - OOG6_106474
Panther 1 1.100 - - LDO PTHR20855
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4360
SonicParanoid 1 1.000 - - X3936
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.