DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7530 and paqr9

DIOPT Version :9

Sequence 1:NP_650387.1 Gene:CG7530 / 41784 FlyBaseID:FBgn0038256 Length:351 Species:Drosophila melanogaster
Sequence 2:XP_017212580.1 Gene:paqr9 / 101886606 ZFINID:ZDB-GENE-161017-79 Length:374 Species:Danio rerio


Alignment Length:342 Identity:68/342 - (19%)
Similarity:99/342 - (28%) Gaps:152/342 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 LCNFDDAPSHLKFNPYIRRGYRTFLPSTKMCLQSIFWWTNETINIWSHLAGCILFIGLTIFDLQF 140
            |....|.|..:. ..:|..|||....|.:.||.|.|..||||.|.|:|      |:.:.:|...|
Zfish     6 LVRHTDVPVRVT-ESFILSGYRFPNYSLRQCLASAFRPTNETGNFWTH------FLPIFVFAFHF 63

  Fly   141 LRLHA-----SLSDQVL---------VVCLLVCFCLCMLMSAIYHIFSCKSEEHYELFLSVDFLG 191
            :.:..     ..||...         |:.||       |.|::.|:.:..|....|:...||:..
Zfish    64 MEVFTWEKVPEPSDPFFYPFWNYFLGVLYLL-------LASSLAHLLNSMSLIIREICFFVDYGT 121

  Fly   192 ISLSLVAIYISGMYYAFWCHTFLRTLYSTIALGMFALAIAVQIPRLNVSMNGKVAVLLLWSAYGI 256
            ||...|.   |.:.|.::.|                       |:..:..||             
Zfish   122 ISAYTVG---SSLAYFYYIH-----------------------PQAGIPENG------------- 147

  Fly   257 IPLGH--------------WAVAMGGLENELV--RLMVPRIVLMYLLC----------------- 288
             |.||              |.......:.:|.  .|.:|...|:.::|                 
Zfish   148 -PCGHNSSERKSLNSDEQTWPSESSPTQVQLFFESLYIPSTCLVAIICVLTCCNTRQRWRKYRYA 211

  Fly   289 ---------------------------------------------------LVAFVFYAAKIPER 302
                                                               :|:.||..:|||||
Zfish   212 VRTLVFLLPFFVSSTPVFYRLLSLSSNSTSSFSPHLSSTMAAFFYRHCFWLVVSAVFNISKIPER 276

  Fly   303 WFTGKVDFVGHSHNWWH 319
            ...|..|..||||.|:|
Zfish   277 VSPGNFDIWGHSHQWFH 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7530NP_650387.1 HlyIII 111..329 CDD:281059 57/307 (19%)
paqr9XP_017212580.1 HlyIII 40..298 CDD:296067 57/307 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1524940at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.