DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7530 and paqr5b

DIOPT Version :9

Sequence 1:NP_650387.1 Gene:CG7530 / 41784 FlyBaseID:FBgn0038256 Length:351 Species:Drosophila melanogaster
Sequence 2:NP_001003573.1 Gene:paqr5b / 100007661 ZFINID:ZDB-GENE-040801-92 Length:347 Species:Danio rerio


Alignment Length:266 Identity:70/266 - (26%)
Similarity:119/266 - (44%) Gaps:51/266 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 GYRTFLPSTKMCLQSIFWWTNETINIWSHLAGCILFIGLTIFDLQFLRLHASLSDQV----LVVC 155
            |||....|...|:.|:|..||||:|:|:|......|    ::.|..:.|...:.::.    |:|.
Zfish    28 GYRHPRSSATECVWSLFQLTNETLNVWTHFLPTWYF----LWKLMTVLLMEDVWNEAYTWPLLVF 88

  Fly   156 LLVCFCLCMLMSAIYHIFSCKSEEHYELFLSVDF-------LGISLSLVA-----IYISGMYYAF 208
            |..| |:..|.|:..|.||..|.....:....|:       ||.::|..|     .::|..::|:
Zfish    89 LFSC-CVYPLASSCAHTFSSMSTRARHICYFFDYGALSFYSLGSAISYSAYVFPDAWLSSSFHAY 152

  Fly   209 WC-----HTFLRT---LYSTIALGMFALAIAV-------QIPRLNVSMNGKVAVLLLWS---AYG 255
            :.     :|.|.|   .||.:.|.:...:..:       |.||::     ||..:|.::   .:.
Zfish   153 YISVAVFNTVLSTSLACYSRLGLPLLHYSHDIVERFSERQCPRMS-----KVLRILAFAYPYLFD 212

  Fly   256 IIPLGH---WAVAMGGLENELVRLMVPRIVLMYLLCLVAFVFYAAKIPERWFTGKVDFVGHSHNW 317
            .|||.:   ..|..|..:||...:.|...:|.:   |.:|:| |..:|||...|:.|::||||..
Zfish   213 NIPLFYRLFVCVGEGCTDNEANSVHVQHTLLAF---LTSFLF-ATHLPERLAPGRFDYIGHSHQL 273

  Fly   318 WHLIIV 323
            :|:..:
Zfish   274 FHVCAI 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7530NP_650387.1 HlyIII 111..329 CDD:281059 64/250 (26%)
paqr5bNP_001003573.1 HlyIII 44..286 CDD:281059 64/250 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1524940at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.