DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kibra and BAG3

DIOPT Version :9

Sequence 1:NP_001034055.1 Gene:kibra / 41783 FlyBaseID:FBgn0262127 Length:1288 Species:Drosophila melanogaster
Sequence 2:NP_004272.2 Gene:BAG3 / 9531 HGNCID:939 Length:575 Species:Homo sapiens


Alignment Length:465 Identity:104/465 - (22%)
Similarity:165/465 - (35%) Gaps:134/465 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   457 ERLKSFSSESTFSISSGSSLGSLSTASSKSALSFTDI---YIDPFAVDSPIDVVD----LRRRSQ 514
            ||.:|.::....|.||.:||.|    |.:|:|....:   ||.       |.|:.    .|..:|
Human   169 ERSQSPAASDCSSSSSSASLPS----SGRSSLGSHQLPRGYIS-------IPVIHEQNVTRPAAQ 222

  Fly   515 RLFQQHQQQRLH------------PVHPVLQ-------------------QQQSAEVTLSPRSSL 548
            ..|  ||.|:.|            ||:..:|                   |..|:......|||.
Human   223 PSF--HQAQKTHYPAQQGEYQTHQPVYHKIQGDDWEPRPLRAASPFRSSVQGASSREGSPARSST 285

  Fly   549 SMETPPASPMKYNAGADQTPQALKEEPTYANALP-----APPAYTAP--PP--VPISGVRARPYD 604
            .:.:|  ||::.:...|:..|.:....|...:.|     :.|....|  ||  :||..:|.   :
Human   286 PLHSP--SPIRVHTVVDRPQQPMTHRETAPVSQPENKPESKPGPVGPELPPGHIPIQVIRK---E 345

  Fly   605 LDSTVLDCMMLEAKLQKLNMGTPLNLAVAPLSPISEKPSLLDLPQEMLSRSSSTSNTRSVSAAVS 669
            :||..:. .......:|:.:..|  .|..|..|.|..||.  :|.   |..|..:..|:..:...
Human   346 VDSKPVS-QKPPPPSEKVEVKVP--PAPVPCPPPSPGPSA--VPS---SPKSVATEERAAPSTAP 402

  Fly   670 NESVAGDSGVFEASRAHLPRKELAQVQIGLKYLKQEGVL--VVSLERANNLLALWTASADN---- 728
            .|:.....|..||...| |         |:  ||.|.:|  |..||:|          .||    
Human   403 AEATPPKPGEAEAPPKH-P---------GV--LKVEAILEKVQGLEQA----------VDNFEGK 445

  Fly   729 --------SQVYLRAALLPNSLTSIRTKALGDFQKPVFNDTFAVPITLDKLLTKSLQVTVVTMTG 785
                    .:.||...||  :|.|:..:...|.::...:....|...|:||..|::.|.      
Human   446 KTDKKYLMIEEYLTKELL--ALDSVDPEGRADVRQARRDGVRKVQTILEKLEQKAIDVP------ 502

  Fly   786 QKEEIIGTVQI------SMAEFNPEDSTLKWYNVLSSKFIPSFESLDIPSTSAAAAAAAVAASNA 844
                  |.||:      ::....|..:.::...|.:.|...:..:.:.|.|......|..||::.
Human   503 ------GQVQVYELQPSNLEADQPLQAIMEMGAVAADKGKKNAGNAEDPHTETQQPEATAAATSN 561

  Fly   845 PN-----PGN 849
            |:     |||
Human   562 PSSMTDTPGN 571

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kibraNP_001034055.1 WW 57..87 CDD:238122
WW 103..132 CDD:278809
C2_Kibra 693..813 CDD:176062 28/139 (20%)
BAG3NP_004272.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..92
WW 21..53 CDD:197736
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 123..200 12/34 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 240..421 42/203 (21%)
BAG 421..498 CDD:214591 22/90 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 532..575 10/40 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.