DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kibra and AT2G33510

DIOPT Version :10

Sequence 1:NP_001034055.1 Gene:kibra / 41783 FlyBaseID:FBgn0262127 Length:1288 Species:Drosophila melanogaster
Sequence 2:NP_001189667.1 Gene:AT2G33510 / 817916 AraportID:AT2G33510 Length:204 Species:Arabidopsis thaliana


Alignment Length:62 Identity:14/62 - (22%)
Similarity:26/62 - (41%) Gaps:8/62 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   233 STIMKLEDNVKFNNSSNEQFSKMTTENQQLKDWMATKTKEVEHAAKMMLELKQKHIEELQMK 294
            |.||..:|....:....|..:|..::..::.:|        :||.:.......|||:|:..|
plant    36 SEIMSEKDGNADSLFLKEGSAKDLSQEGRVNNW--------QHALRKRASRTGKHIQEMTWK 89

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kibraNP_001034055.1 WW 57..87 CDD:238122
WW 103..132 CDD:459800
C2_Kibra 693..813 CDD:176062
AT2G33510NP_001189667.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.