DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kibra and herc5.2

DIOPT Version :9

Sequence 1:NP_001034055.1 Gene:kibra / 41783 FlyBaseID:FBgn0262127 Length:1288 Species:Drosophila melanogaster
Sequence 2:XP_005160175.1 Gene:herc5.2 / 794323 ZFINID:ZDB-GENE-090311-16 Length:987 Species:Danio rerio


Alignment Length:249 Identity:54/249 - (21%)
Similarity:97/249 - (38%) Gaps:72/249 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   846 NPGNNREESSDESTITSSQTSTLTRNQA------------PCM--ELQEQMAAELLGLGPLNEPE 896
            ||||  |.:..:|::..   ..||.|..            |.:  |:::..::.:...|...:|.
Zfish   351 NPGN--ESTKPKSSMNG---GILTLNDRMIDRWVSGSYPWPTVKKEIKKVFSSAVCLNGSFLKPS 410

  Fly   897 CSDDDDD----DEEEELDDKQLVSDVGLMNSSSMLHAYLQNMKQEFADKETNTDRAYLPEKSRGQ 957
            ..:.|.|    ...:..|:::::|:|..:...::    |.::..:.|.:|:......|||..:|.
Zfish   411 LDEQDFDLVGKSFSKLTDNEKVISEVVKVIQQTL----LPSLNPKPAHEESLRLYLLLPELIKGL 471

  Fly   958 SQLMDDRPVKRSQTFTPSEAFSKNRYNCRLNRSDSDSAMHCGVAPHTFQRGAAERRSLR-FHSKA 1021
            .|      .:||:                ||::         :|....|..:|.|..|. |.||.
Zfish   472 EQ------YQRSE----------------LNKA---------LASKILQLNSAAREMLEMFWSKL 505

  Fly  1022 P----KSVTKLHHTHIPRTSLDLELDLQAQHSKLYFLNDQIAKLQNLKEVLQKA 1071
            |    ||:.||.|    :.|.||     ..:..:..::..:..||||..:||.|
Zfish   506 PDDWLKSLVKLFH----KESADL-----IDYMSVCAMDSDLKHLQNLLRILQMA 550

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kibraNP_001034055.1 WW 57..87 CDD:238122
WW 103..132 CDD:278809
C2_Kibra 693..813 CDD:176062
herc5.2XP_005160175.1 RCC1_2 120..149 CDD:290274
RCC1 136..186 CDD:278826
RCC1 189..238 CDD:278826
RCC1 242..290 CDD:278826
RCC1 296..347 CDD:278826
HECTc 649..985 CDD:294058
HECTc 678..984 CDD:214523
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.