DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kibra and Herc6

DIOPT Version :9

Sequence 1:NP_001034055.1 Gene:kibra / 41783 FlyBaseID:FBgn0262127 Length:1288 Species:Drosophila melanogaster
Sequence 2:NP_080268.1 Gene:Herc6 / 67138 MGIID:1914388 Length:1003 Species:Mus musculus


Alignment Length:516 Identity:99/516 - (19%)
Similarity:176/516 - (34%) Gaps:190/516 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 PYYINH---------LAQSTQLEDPRQEWKTVQEQMLSDYLSAAQDQLENKREMFDVKQQRLLWA 172
            ||...|         |.:.:.::||: .|||    :..::..|.     :|.....:...|..||
Mouse   470 PYSSPHQEALLVFLLLPECSIMQDPK-NWKT----LAFEFAKAI-----HKMGPQSLAFLRTCWA 524

  Fly   173 QEEYNHLKLAAS--RSSLCSSSSSMSRHDPELLRADLML-ARERVH----QLKQ------ELTHI 224
            ..|.:.|.:...  :.::.|........:..:....::| ..:.||    ||.:      ||:.|
Mouse   525 SLEVSSLNILVQMLKKAIISQIQYGVATEQYITNIKVLLEVIKEVHKANCQLPESAFIINELSGI 589

  Fly   225 -------------TNDISYTERGMNTLYS-------VGEKINARENGCYD--IAEVHAIREEM-- 265
                         .||:..||.....::|       :..||...:...:.  ::||.|..|:|  
Mouse   590 FNFDAEAGRMFIRHNDLDCTESSDMVVFSDFLFVFDLPSKIKLMKCDSFVKLMSEVMAFPEKMSS 654

  Fly   266 -----LKVHKS-LVSGEKVREELMRSLVQIKN-ELGRQ-------QISEENSDLASPFDRVCVAS 316
                 |||.:| ||      |:.:|.|.|::: :|.:|       :|..|...::|.|.......
Mouse   655 PPYLILKVRRSHLV------EDTLRQLRQVEDFDLRKQLSVGFINEIRPEAGGVSSEFFHCIFEE 713

  Fly   317 QTD---------------------------------LCGSSGENLNGGARFAEMAKTKWQYAEWR 348
            .||                                 |||.|..||       ::....:..|.::
Mouse   714 MTDPKYEMFIYPEKGSSMWFPVNPKFEKSSYFLFGILCGLSLHNL-------KVINLPFPLALYK 771

  Fly   349 K---------HIKKLQQQLADHVERI---EPGQLES---------DKDRILLIQEKEKL-LNDLN 391
            |         .:|:|...|..:::.:   |.|.:|.         |:..:.||.:...: :|:.|
Mouse   772 KLLNQKPSLEDLKELSLPLGRNLQEVLNCEAGDIEELHMYFSIYWDQKDVDLIPDGISVPVNETN 836

  Fly   392 -------------SISLKSRSEEEKRVIHQT------RHKLEEDLKEAYEANNTCVANRLR---- 433
                         :||:|:..||..|..::.      |....|:|..|...|.||...:..    
Mouse   837 KRDYVSKYVDYIFNISIKTIYEEFHRGFYKVCNWDIIRQFQPEELMTAIIGNATCDWKQFENNSK 901

  Fly   434 ------------------FH-----EEKQLLL-----DKLQ-EALKSTKLLEERLKSFSSE 465
                              ||     |:|:.||     |:|. :.|::..::....::||.|
Mouse   902 YKDGYDKSHPTILLFWKAFHDLTLDEKKKFLLFLTGCDRLHVKGLQNEGIVFRCSETFSEE 962

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kibraNP_001034055.1 WW 57..87 CDD:238122
WW 103..132 CDD:278809 4/23 (17%)
C2_Kibra 693..813 CDD:176062
Herc6NP_080268.1 RCC1 1 40..91
RCC1 40..89 CDD:278826
RCC1 2 92..144
RCC1 92..142 CDD:278826
RCC1 145..195 CDD:278826
RCC1 3 146..197
RCC1_2 183..211 CDD:290274
RCC1 4 199..252
RCC1_2 237..266 CDD:290274
RCC1 5 253..303
RCC1 253..300 CDD:278826
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 261..281
chaperonin_like <570..>652 CDD:295468 17/81 (21%)
HECTc 658..999 CDD:238033 62/318 (19%)
HECTc 682..999 CDD:214523 52/288 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.